DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nSyb and ykt6

DIOPT Version :9

Sequence 1:NP_001261269.1 Gene:nSyb / 38196 FlyBaseID:FBgn0013342 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_989023.1 Gene:ykt6 / 394619 XenbaseID:XB-GENE-949728 Length:198 Species:Xenopus tropicalis


Alignment Length:52 Identity:15/52 - (28%)
Similarity:29/52 - (55%) Gaps:0/52 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQAGK 93
            :.:.||::||...|:...:|.:|:|..||.:|..:::.|...:..|.:.|.|
 Frog   139 MSKVQAELDETKIILHNTMESLLQRGEKLDDLVSKSEVLGTQSKAFYKTARK 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nSybNP_001261269.1 Synaptobrevin 39..120 CDD:279324 15/52 (29%)
R-SNARE_VAMP2 40..102 CDD:277223 15/52 (29%)
ykt6NP_989023.1 SNC1 3..198 CDD:227472 15/52 (29%)
R-SNARE_YKT6 136..195 CDD:277220 15/52 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.