DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nSyb and vamp4

DIOPT Version :9

Sequence 1:NP_001261269.1 Gene:nSyb / 38196 FlyBaseID:FBgn0013342 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_957029.2 Gene:vamp4 / 393708 ZFINID:ZDB-GENE-040625-92 Length:153 Species:Danio rerio


Alignment Length:107 Identity:38/107 - (35%)
Similarity:67/107 - (62%) Gaps:3/107 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EGGDGE---IVGGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQ 81
            |..|.|   .:.||..|:......:::|.|:|||||:|:|:.|:.||:||..:|.||.|::::|.
Zfish    41 EDSDEEEDFFLRGPTGPRFGGQNDKIRQVQSQVDEVIDVMQENISKVIERGERLDELQDKSESLS 105

  Fly    82 QGASQFEQQAGKLKRKFWLQNLKMMIIMGVIGLVVVGIIAKP 123
            ..||.|..:|.:|.|:.|.::.||.:|:.::.::::.||..|
Zfish   106 DNASAFSSRAKQLHRRMWWRDTKMKMIVALVVVILLLIIIVP 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nSybNP_001261269.1 Synaptobrevin 39..120 CDD:279324 29/80 (36%)
R-SNARE_VAMP2 40..102 CDD:277223 26/61 (43%)
vamp4NP_957029.2 Synaptobrevin 62..>131 CDD:279324 28/68 (41%)
R-SNARE_VAMP4 63..129 CDD:277222 26/65 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.