DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nSyb and sybl1

DIOPT Version :9

Sequence 1:NP_001261269.1 Gene:nSyb / 38196 FlyBaseID:FBgn0013342 Length:206 Species:Drosophila melanogaster
Sequence 2:XP_005157192.1 Gene:sybl1 / 393236 ZFINID:ZDB-GENE-040426-1055 Length:220 Species:Danio rerio


Alignment Length:80 Identity:26/80 - (32%)
Similarity:46/80 - (57%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQAGKLKRKFWLQNLKM 105
            ||.:||.|||::..||..|::.|.:|..:|..|.|:.:.|...:..|:..:..|.....::|||:
Zfish   125 RLTETQMQVDDLKGIMVRNIDLVAQRGERLELLIDKTENLMDSSVTFKTTSRNLAHAMCMKNLKL 189

  Fly   106 MIIMGVIGLVVVGII 120
            .:|:.::.|||:..|
Zfish   190 TVIVVIVVLVVLYFI 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nSybNP_001261269.1 Synaptobrevin 39..120 CDD:279324 25/78 (32%)
R-SNARE_VAMP2 40..102 CDD:277223 18/60 (30%)
sybl1XP_005157192.1 SNC1 1..172 CDD:227472 16/46 (35%)
Longin 29..98 CDD:290490
Synaptobrevin 122..210 CDD:279324 26/80 (33%)
R-SNARE_VAMP7 124..188 CDD:277224 19/62 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.