DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nSyb and snb-7

DIOPT Version :9

Sequence 1:NP_001261269.1 Gene:nSyb / 38196 FlyBaseID:FBgn0013342 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001023622.1 Gene:snb-7 / 3565852 WormBaseID:WBGene00014084 Length:102 Species:Caenorhabditis elegans


Alignment Length:96 Identity:28/96 - (29%)
Similarity:53/96 - (55%) Gaps:8/96 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 HNPQQIAA----QKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQA 91
            |.|..::.    .:::.:|:.::|.|..||:.||:|::||..||.:|.:||..|::.:..:.:.|
 Worm     3 HQPPPVSRVGWDDQKIMRTRRELDSVKAIMKENVQKIMERQGKLDDLVERAQRLEEASDVYVKCA 67

  Fly    92 GKLKRKF-WLQNLKMMIIMGVIGLVVVGIIA 121
            .|:||:. |..|   .:..|:|.:..|...|
 Worm    68 VKIKREMSWKAN---SLRYGIIAVSSVSAFA 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nSybNP_001261269.1 Synaptobrevin 39..120 CDD:279324 25/81 (31%)
R-SNARE_VAMP2 40..102 CDD:277223 21/62 (34%)
snb-7NP_001023622.1 Synaptobrevin 14..88 CDD:366387 24/76 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158961
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45701
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.