DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nSyb and Sec22b

DIOPT Version :9

Sequence 1:NP_001261269.1 Gene:nSyb / 38196 FlyBaseID:FBgn0013342 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001020857.1 Gene:Sec22b / 310710 RGDID:1309988 Length:215 Species:Rattus norvegicus


Alignment Length:80 Identity:22/80 - (27%)
Similarity:41/80 - (51%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 AQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQAGKLKRKFWLQN 102
            |::.|.....::.:|..||..|:|:||:|...||.||.:|:.|...:.::.|.|..|..:.....
  Rat   131 ARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNMRSTYAK 195

  Fly   103 LKMMIIMGVIGLVVV 117
            |..:.:..::.:|.|
  Rat   196 LAAVAVFFIMLIVYV 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nSybNP_001261269.1 Synaptobrevin 39..120 CDD:279324 21/79 (27%)
R-SNARE_VAMP2 40..102 CDD:277223 18/61 (30%)
Sec22bNP_001020857.1 Longin 3..126 CDD:341428
R-SNARE_SEC22 132..195 CDD:277219 18/62 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.