DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nSyb and Sec22

DIOPT Version :9

Sequence 1:NP_001261269.1 Gene:nSyb / 38196 FlyBaseID:FBgn0013342 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_001259103.1 Gene:Sec22 / 31030 FlyBaseID:FBgn0260855 Length:213 Species:Drosophila melanogaster


Alignment Length:85 Identity:25/85 - (29%)
Similarity:47/85 - (55%) Gaps:4/85 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QQIAAQKR-LQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQAGKLKRK 97
            :|:..::| :.....|:.:|..||..|::.||:|.:.|:|||.:...|...:.::::.|..|.||
  Fly   126 KQLTDRRRNISNINTQLQDVQRIMVQNIDDVLQRGTVLAELDTKTQNLSMMSQKYKKDAKLLNRK 190

  Fly    98 FWLQNLKMMIIMGVIGLVVV 117
              ...:|.| .:|:|.||.:
  Fly   191 --SMYVKAM-ALGMILLVFI 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nSybNP_001261269.1 Synaptobrevin 39..120 CDD:279324 24/80 (30%)
R-SNARE_VAMP2 40..102 CDD:277223 18/62 (29%)
Sec22NP_001259103.1 SNC1 10..192 CDD:227472 19/67 (28%)
Longin 39..105 CDD:290490
R-SNARE_SEC22 132..195 CDD:277219 18/64 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448300
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.