DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nSyb and Vamp3

DIOPT Version :9

Sequence 1:NP_001261269.1 Gene:nSyb / 38196 FlyBaseID:FBgn0013342 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_476438.1 Gene:Vamp3 / 29528 RGDID:61880 Length:103 Species:Rattus norvegicus


Alignment Length:108 Identity:62/108 - (57%)
Similarity:72/108 - (66%) Gaps:13/108 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NAGAPAGEGGDGEIVGGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRA 77
            :.|.|:|...            ...:.:||||||.||||||||||.||:||||||.|||||||||
  Rat     2 STGVPSGSSA------------ATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRA 54

  Fly    78 DALQQGASQFEQQAGKLKRKFWLQNLKMMIIMGVIGLVVVGII 120
            ||||.||||||..|.|||||:|.:|.||..| |:..||::.||
  Rat    55 DALQAGASQFETSAAKLKRKYWWKNCKMWAI-GISVLVIIVII 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nSybNP_001261269.1 Synaptobrevin 39..120 CDD:279324 57/80 (71%)
R-SNARE_VAMP2 40..102 CDD:277223 50/61 (82%)
Vamp3NP_476438.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25 9/34 (26%)
R-SNARE_VAMP2 17..79 CDD:277223 50/61 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103752
Panther 1 1.100 - - LDO PTHR45701
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X424
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.770

Return to query results.
Submit another query.