DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nSyb and syb1

DIOPT Version :9

Sequence 1:NP_001261269.1 Gene:nSyb / 38196 FlyBaseID:FBgn0013342 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_594120.1 Gene:syb1 / 2541731 PomBaseID:SPAC6G9.11 Length:121 Species:Schizosaccharomyces pombe


Alignment Length:113 Identity:37/113 - (32%)
Similarity:59/113 - (52%) Gaps:13/113 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 APPNAGAPAGEGGDGEIVGGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELD 74
            |.|:|...:|...    .....|.:..|.|:       |:|:.|.|||.|:.||.||..:|..|.
pombe    11 AEPSAAVRSGNAA----ASSTPNMKTAAIQQ-------QIDDTVGIMRENISKVSERGERLDSLQ 64

  Fly    75 DRADALQQGASQFEQQAGKLKRKFWLQNLKM--MIIMGVIGLVVVGII 120
            |:.|.|...|..|.:.|.::::|.|.::::|  .||:|:|.|:||.|:
pombe    65 DKTDNLAVSAQGFRRGANRVRKKMWWKDMRMRLCIIIGIIILLVVIIV 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nSybNP_001261269.1 Synaptobrevin 39..120 CDD:279324 30/82 (37%)
R-SNARE_VAMP2 40..102 CDD:277223 21/61 (34%)
syb1NP_594120.1 SNC1 <2..96 CDD:227472 28/95 (29%)
R-SNARE_Snc1 30..89 CDD:277227 22/65 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 70 1.000 Domainoid score I2659
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I1906
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000385
OrthoInspector 1 1.000 - - otm47128
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45701
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1430
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.990

Return to query results.
Submit another query.