DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nSyb and ykt6

DIOPT Version :9

Sequence 1:NP_001261269.1 Gene:nSyb / 38196 FlyBaseID:FBgn0013342 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_596561.1 Gene:ykt6 / 2539873 PomBaseID:SPBC13G1.11 Length:197 Species:Schizosaccharomyces pombe


Alignment Length:62 Identity:21/62 - (33%)
Similarity:33/62 - (53%) Gaps:3/62 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQAGK 93
            :|:|.....|:||   ::||..|::...:|.||.|..||.:|..|:|.|...:..|.:.|.|
pombe   131 DPKQADTIMRVQQ---ELDETKDVLHKTIESVLARGEKLDDLIQRSDNLSTQSRMFYKSAKK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nSybNP_001261269.1 Synaptobrevin 39..120 CDD:279324 19/55 (35%)
R-SNARE_VAMP2 40..102 CDD:277223 19/54 (35%)
ykt6NP_596561.1 SNC1 3..197 CDD:227472 21/62 (34%)
Longin 44..114 CDD:290490
R-SNARE_YKT6 135..194 CDD:277220 19/58 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.