DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nSyb and Vamp2

DIOPT Version :9

Sequence 1:NP_001261269.1 Gene:nSyb / 38196 FlyBaseID:FBgn0013342 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_033523.1 Gene:Vamp2 / 22318 MGIID:1313277 Length:116 Species:Mus musculus


Alignment Length:117 Identity:76/117 - (64%)
Similarity:87/117 - (74%) Gaps:8/117 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AAPAGDAPPNAGAPAGEGGDGEIVGGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDS 68
            :|.|...||  .|||||||.      |..|..:.:.:|||||||||||||||||.||:||||||.
Mouse     2 SATAATVPP--AAPAGEGGP------PAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQ 58

  Fly    69 KLSELDDRADALQQGASQFEQQAGKLKRKFWLQNLKMMIIMGVIGLVVVGII 120
            |||||||||||||.||||||..|.|||||:|.:|||||||:|||..:::.||
Mouse    59 KLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIII 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nSybNP_001261269.1 Synaptobrevin 39..120 CDD:279324 61/80 (76%)
R-SNARE_VAMP2 40..102 CDD:277223 51/61 (84%)
Vamp2NP_033523.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 13/33 (39%)
R-SNARE_VAMP2 30..92 CDD:277223 51/61 (84%)
Required for interaction with SEPT8. /evidence=ECO:0000250|UniProtKB:P63045 92..116 12/19 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7591
Inparanoid 1 1.050 140 1.000 Inparanoid score I4486
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000385
OrthoInspector 1 1.000 - - mtm8786
orthoMCL 1 0.900 - - OOG6_103752
Panther 1 1.100 - - O PTHR45701
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1430
SonicParanoid 1 1.000 - - X424
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.850

Return to query results.
Submit another query.