DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nSyb and Vamp1

DIOPT Version :9

Sequence 1:NP_001261269.1 Gene:nSyb / 38196 FlyBaseID:FBgn0013342 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_033522.1 Gene:Vamp1 / 22317 MGIID:1313276 Length:118 Species:Mus musculus


Alignment Length:119 Identity:70/119 - (58%)
Similarity:84/119 - (70%) Gaps:10/119 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AAPAGDAPPNAGAPAGEGGDGEIVGG--PHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLER 66
            :|||        .|..||.:|...||  |..|..:.:.:|||||||||:|||||||.||:|||||
Mouse     2 SAPA--------QPPAEGTEGAAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIMRVNVDKVLER 58

  Fly    67 DSKLSELDDRADALQQGASQFEQQAGKLKRKFWLQNLKMMIIMGVIGLVVVGII 120
            |.|||||||||||||.||||||..|.|||||:|.:|.||||::|.|..::|.:|
Mouse    59 DQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCKMMIMLGAICAIIVVVI 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nSybNP_001261269.1 Synaptobrevin 39..120 CDD:279324 58/80 (73%)
R-SNARE_VAMP2 40..102 CDD:277223 50/61 (82%)
Vamp1NP_033522.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 13/41 (32%)
R-SNARE_VAMP2 32..94 CDD:277223 50/61 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I4486
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000385
OrthoInspector 1 1.000 - - mtm8786
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45701
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X424
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.920

Return to query results.
Submit another query.