powered by:
Protein Alignment nSyb and sec-22
DIOPT Version :9
Sequence 1: | NP_001261269.1 |
Gene: | nSyb / 38196 |
FlyBaseID: | FBgn0013342 |
Length: | 206 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_508198.1 |
Gene: | sec-22 / 180456 |
WormBaseID: | WBGene00018853 |
Length: | 214 |
Species: | Caenorhabditis elegans |
Alignment Length: | 68 |
Identity: | 19/68 - (27%) |
Similarity: | 37/68 - (54%) |
Gaps: | 2/68 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 QVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQAGKLKRKFWLQNLKMMIIMGVI 112
::.:|..||.||:|.|:.|...|:.|::||..|...:.::...|..|.|:..: .|:...:|:.
Worm 140 ELQDVTRIMVTNIEDVIHRGEALNILENRASELSGMSKKYRDDAKALNRRSTI--FKVAASIGIA 202
Fly 113 GLV 115
|::
Worm 203 GVL 205
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5143 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.