DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nSyb and snb-2

DIOPT Version :9

Sequence 1:NP_001261269.1 Gene:nSyb / 38196 FlyBaseID:FBgn0013342 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_506093.2 Gene:snb-2 / 179692 WormBaseID:WBGene00004898 Length:114 Species:Caenorhabditis elegans


Alignment Length:102 Identity:52/102 - (50%)
Similarity:73/102 - (71%) Gaps:8/102 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EGGDGEI--VGGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQ 82
            |.|:||.  ..|.:|      .||:|..||||:||:|:||.||.||:|||.:|:.||.||:.||.
 Worm    12 EAGNGEAQPPTGTYN------TKRMQMAQAQVNEVIDVMRNNVNKVMERDVQLNSLDHRAEVLQN 70

  Fly    83 GASQFEQQAGKLKRKFWLQNLKMMIIMGVIGLVVVGI 119
            |||||:|.:..|::|:|.||::||||:|:|..:|:||
 Worm    71 GASQFQQSSRTLRQKYWWQNIRMMIIIGLIAFLVIGI 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nSybNP_001261269.1 Synaptobrevin 39..120 CDD:279324 46/81 (57%)
R-SNARE_VAMP2 40..102 CDD:277223 35/61 (57%)
snb-2NP_506093.2 R-SNARE_VAMP2 28..90 CDD:277223 35/61 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45701
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.