DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nSyb and vamp-7

DIOPT Version :9

Sequence 1:NP_001261269.1 Gene:nSyb / 38196 FlyBaseID:FBgn0013342 Length:206 Species:Drosophila melanogaster
Sequence 2:NP_500232.3 Gene:vamp-7 / 177041 WormBaseID:WBGene00022077 Length:261 Species:Caenorhabditis elegans


Alignment Length:85 Identity:29/85 - (34%)
Similarity:56/85 - (65%) Gaps:1/85 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 AAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQAGKLKRKFWLQ 101
            |.|:|:...:.|||:|..:|..|||:::||..:|..:::|.:||:..|:.|:..|.:::|.|..:
 Worm   167 AQQQRMIDIRRQVDDVRQVMADNVERIMERGERLENMENRTEALRTSATSFKSTARRVQRHFCQK 231

  Fly   102 NLK-MMIIMGVIGLVVVGII 120
            ||| .:|::.|:.::|..|:
 Worm   232 NLKWTLILLLVVTIIVAAIV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nSybNP_001261269.1 Synaptobrevin 39..120 CDD:279324 27/81 (33%)
R-SNARE_VAMP2 40..102 CDD:277223 20/61 (33%)
vamp-7NP_500232.3 Synaptobrevin 168..256 CDD:366387 28/84 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000385
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1430
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.