DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13926 and hikeshi

DIOPT Version :9

Sequence 1:NP_647633.1 Gene:CG13926 / 38192 FlyBaseID:FBgn0035243 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_001017577.1 Gene:hikeshi / 550239 ZFINID:ZDB-GENE-050417-34 Length:197 Species:Danio rerio


Alignment Length:200 Identity:92/200 - (46%)
Similarity:123/200 - (61%) Gaps:10/200 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFGLIVSGRLPQSDFVAVDATKLLVNVPDIESVNYLVVFLTGVSPLPVGTSAAIYFSWPDANAAP 67
            :||.:|:|||.|:|...|.:.|.:.|:||.|.||::||||.|..|.|.|...|:|...|...|..
Zfish     1 MFGCLVAGRLVQTDAQQVASDKFVFNLPDYEHVNHVVVFLLGTVPFPEGLGGAVYLCVPGGAAGQ 65

  Fly    68 TWQYLGHINNTKPSAIFKIAQLKKSHELEAQAH--GMVFGSQEISHIAQIGVSLEPELTVAQQTP 130
            .||.||.|.|.||||||:|:.||..   |..:|  ||: .:.....:||:|||:|....:|||||
Zfish    66 VWQLLGFITNEKPSAIFRISGLKAG---EGSSHPFGMM-DAPAAPSMAQVGVSVEGLHLLAQQTP 126

  Fly   131 ----AVSTANDNKQFGQRMLENFFNYASSFGVAARDIPPISSETFVPFSVVQNWYTNFQRRMEQN 191
                ||||.:...||.|:||::.||:.|||.::...:.|..||.|:|.|.::.||.|||||:.||
Zfish   127 VSSSAVSTLDSFTQFTQKMLDSLFNFTSSFALSQSRMSPNPSEMFIPASSIRRWYENFQRRLMQN 191

  Fly   192 PNFWK 196
            |||||
Zfish   192 PNFWK 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13926NP_647633.1 DUF775 3..192 CDD:283295 86/194 (44%)
hikeshiNP_001017577.1 DUF775 1..192 CDD:283295 86/194 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578639
Domainoid 1 1.000 166 1.000 Domainoid score I3852
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6908
Inparanoid 1 1.050 168 1.000 Inparanoid score I4137
OMA 1 1.010 - - QHG55986
OrthoDB 1 1.010 - - D1223488at2759
OrthoFinder 1 1.000 - - FOG0005749
OrthoInspector 1 1.000 - - oto41570
orthoMCL 1 0.900 - - OOG6_102809
Panther 1 1.100 - - LDO PTHR12925
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R869
SonicParanoid 1 1.000 - - X4730
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.