DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13926 and HIKESHI

DIOPT Version :9

Sequence 1:NP_647633.1 Gene:CG13926 / 38192 FlyBaseID:FBgn0035243 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_057485.2 Gene:HIKESHI / 51501 HGNCID:26938 Length:197 Species:Homo sapiens


Alignment Length:201 Identity:95/201 - (47%)
Similarity:129/201 - (64%) Gaps:12/201 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFGLIVSGRLPQSDFVAVDATKLLVNVPDIESVNYLVVFLTGVSPLPVGTSAAIYFSWPDANAAP 67
            :||.:|:|||.|:....|...|.:.::||.||:|::|||:.|..|.|.|...::|||:||:|..|
Human     1 MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYESINHVVVFMLGTIPFPEGMGGSVYFSYPDSNGMP 65

  Fly    68 TWQYLGHINNTKPSAIFKIAQLKKSHELEAQAHGMVFGSQEI---SHIAQIGVSLEPELTVAQQT 129
            .||.||.:.|.||||||||:.||..   |...|  .||:..|   ..:||||:|:|...::||||
Human    66 VWQLLGFVTNGKPSAIFKISGLKSG---EGSQH--PFGAMNIVRTPSVAQIGISVELLDSMAQQT 125

  Fly   130 P----AVSTANDNKQFGQRMLENFFNYASSFGVAARDIPPISSETFVPFSVVQNWYTNFQRRMEQ 190
            |    |||:.:...||.|:||:||:|:||||.|:...:.|..||.|:|.:||..||.|||||:.|
Human   126 PVGNAAVSSVDSFTQFTQKMLDNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQ 190

  Fly   191 NPNFWK 196
            ||.|||
Human   191 NPLFWK 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13926NP_647633.1 DUF775 3..192 CDD:283295 90/195 (46%)
HIKESHINP_057485.2 DUF775 1..195 CDD:398953 92/198 (46%)
Required for F-X-F-G repeats-nucleoporins recognition and nuclear import. /evidence=ECO:0000269|PubMed:22541429 18..55 14/36 (39%)
Flexible linker region involved in nuclear import of HSP70 proteins. /evidence=ECO:0000269|PubMed:22541429 124..134 5/9 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145375
Domainoid 1 1.000 178 1.000 Domainoid score I3589
eggNOG 1 0.900 - - E1_KOG4067
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6908
Inparanoid 1 1.050 180 1.000 Inparanoid score I4016
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55986
OrthoDB 1 1.010 - - D1223488at2759
OrthoFinder 1 1.000 - - FOG0005749
OrthoInspector 1 1.000 - - oto88754
orthoMCL 1 0.900 - - OOG6_102809
Panther 1 1.100 - - LDO PTHR12925
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R869
SonicParanoid 1 1.000 - - X4730
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.