Sequence 1: | NP_001261267.1 | Gene: | CG12104 / 38187 | FlyBaseID: | FBgn0035238 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_055643.1 | Gene: | TOX4 / 9878 | HGNCID: | 20161 | Length: | 621 | Species: | Homo sapiens |
Alignment Length: | 591 | Identity: | 115/591 - (19%) |
---|---|---|---|
Similarity: | 156/591 - (26%) | Gaps: | 347/591 - (58%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 FHTPSFGDEVFE-----------------------LTDTPAESQSPSQASR-------------- 31
Fly 32 -------------RMLSLDQSM------------------------------LNDDDEENCDTYA 53
Fly 54 SGGGQNLL---VQPEQQ-------------------------QNQAMAQA--------------- 75
Fly 76 --PPKPLAPFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKREYVR 138
Fly 139 LMRGYRHQLSESEGTSEA----EAPPAVATNQPPPLVT--------------------------- 172
Fly 173 -----------------TKL--------------------------------------------- 175
Fly 176 --------------------------------------------ESVEDLQQ------------- 183
Fly 184 --SVDAQQEPPPDQIQLL---------------------------TEAARVQ------------- 206
Fly 207 ---------------------------KCTREQCNKPAIINPDWEDEYCSNECVVIHCRNVFNHW 244
Fly 245 VISMNS 250 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12104 | NP_001261267.1 | HMG-box | 76..140 | CDD:238037 | 31/63 (49%) |
TOX4 | NP_055643.1 | NHP6B | 140..>306 | CDD:227935 | 45/166 (27%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 153..227 | 10/73 (14%) | |||
Nuclear localization signal. /evidence=ECO:0000255 | 213..218 | 0/4 (0%) | |||
HMG-box | 223..288 | CDD:238037 | 31/64 (48%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 305..333 | 8/28 (29%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 510..529 | 2/18 (11%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 73 | 1.000 | Domainoid score | I9245 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000742 | |
OrthoInspector | 1 | 1.000 | - | - | otm40922 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R4401 |
SonicParanoid | 1 | 1.000 | - | - | X923 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
6 | 6.030 |