| Sequence 1: | NP_001261267.1 | Gene: | CG12104 / 38187 | FlyBaseID: | FBgn0035238 | Length: | 250 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_055544.1 | Gene: | TOX / 9760 | HGNCID: | 18988 | Length: | 526 | Species: | Homo sapiens |
| Alignment Length: | 324 | Identity: | 76/324 - (23%) |
|---|---|---|---|
| Similarity: | 119/324 - (36%) | Gaps: | 117/324 - (36%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 17 TDTPAESQSPSQASRRMLSLDQSMLNDDDEENCDTYASGGGQ-----NLLVQPE--QQQNQAMAQ 74
Fly 75 APPKPLAPFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKREYVRL 139
Fly 140 MRGYRHQLSESEGTSEAEAPPAVATNQPPPLVTTK------------------------------ 174
Fly 175 -----------------------------------LESVEDLQQSVDAQQEPP-----------P 193
Fly 194 DQIQLLTEAARVQKCTREQCNKPAIINP---------------------------DWEDEYCSN 230 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG12104 | NP_001261267.1 | HMG-box | 76..140 | CDD:238037 | 30/63 (48%) |
| TOX | NP_055544.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 138..178 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 192..264 | 13/68 (19%) | |||
| Nuclear localization signal. /evidence=ECO:0000255 | 237..256 | 1/18 (6%) | |||
| NHP6B | <257..>360 | CDD:227935 | 44/106 (42%) | ||
| HMG-box | 261..>310 | CDD:238037 | 24/48 (50%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 73 | 1.000 | Domainoid score | I9245 |
| eggNOG | 1 | 0.900 | - | - | E1_COG5648 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000742 | |
| OrthoInspector | 1 | 1.000 | - | - | otm40922 | |
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X923 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 7 | 6.770 | |||||