DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12104 and NHP6A

DIOPT Version :9

Sequence 1:NP_001261267.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_015377.1 Gene:NHP6A / 856165 SGDID:S000006256 Length:93 Species:Saccharomyces cerevisiae


Alignment Length:81 Identity:15/81 - (18%)
Similarity:37/81 - (45%) Gaps:5/81 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 LVQPEQQQNQAMAQ-----APPKPLAPFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDET 120
            :|.|.:.:.:...:     ||.:.|:.:..|..:....::.:||..:..|:...:...|::|...
Yeast     1 MVTPREPKKRTTRKKKDPNAPKRALSAYMFFANENRDIVRSENPDITFGQVGKKLGEKWKALTPE 65

  Fly   121 QKNVYALRHEQEKREY 136
            :|..|..:.:.:|:.|
Yeast    66 EKQPYEAKAQADKKRY 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12104NP_001261267.1 HMG-box 76..140 CDD:238037 12/61 (20%)
NHP6ANP_015377.1 NHP6B <1..>93 CDD:227935 15/81 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.