DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12104 and NHP6B

DIOPT Version :10

Sequence 1:NP_647629.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_009647.2 Gene:NHP6B / 852386 SGDID:S000002157 Length:99 Species:Saccharomyces cerevisiae


Alignment Length:79 Identity:16/79 - (20%)
Similarity:38/79 - (48%) Gaps:5/79 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 QPEQQQNQAMAQ-----APPKPLAPFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQK 122
            ||::.:.:...:     ||.:.|:.:..|..:....::.:||..:..|:..|:...|::|...:|
Yeast     9 QPKEPKKRTTRRKKDPNAPKRGLSAYMFFANENRDIVRSENPDVTFGQVGRILGERWKALTAEEK 73

  Fly   123 NVYALRHEQEKREY 136
            ..|..:.:.:|:.|
Yeast    74 QPYESKAQADKKRY 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12104NP_647629.1 HMG-box_SF 78..144 CDD:469606 12/59 (20%)
NHP6BNP_009647.2 HMG-box_NHP6-like 14..94 CDD:438792 14/74 (19%)

Return to query results.
Submit another query.