DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12104 and NHP10

DIOPT Version :9

Sequence 1:NP_001261267.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_010282.3 Gene:NHP10 / 851562 SGDID:S000002160 Length:203 Species:Saccharomyces cerevisiae


Alignment Length:155 Identity:34/155 - (21%)
Similarity:62/155 - (40%) Gaps:34/155 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SQASRRMLSLD--------QSMLNDDDEENCD----TYASGGGQNLLVQP------------EQQ 67
            |:.|.:.|.|:        :|.:..|.|.||:    |.|| ..|.||.:|            |:.
Yeast    27 SRLSVKRLKLEYGVLLERLESRIELDPELNCEDPLPTLAS-FKQELLTKPFRKSKTKRHKVKERD 90

  Fly    68 QNQAMAQAPPKPLAPFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQE 132
            .|.     |.:|...:.|:.......|:|..   ||:..:.:.:. |::|:|..:..|...:.::
Yeast    91 PNM-----PKRPTNAYLLYCEMNKERIRQNG---SLDVTRDLAEG-WKNLNEQDRKPYYKLYSED 146

  Fly   133 KREYVRLMRGYRHQLSESEGTSEAE 157
            :..|...|..|..::|..:...:.|
Yeast   147 RERYQMEMEIYNKKISNIDADDDKE 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12104NP_001261267.1 HMG-box 76..140 CDD:238037 12/63 (19%)
NHP10NP_010282.3 NHP6B 24..203 CDD:227935 34/155 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.