DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12104 and TOX2

DIOPT Version :9

Sequence 1:NP_001261267.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_006723947.1 Gene:TOX2 / 84969 HGNCID:16095 Length:515 Species:Homo sapiens


Alignment Length:313 Identity:75/313 - (23%)
Similarity:107/313 - (34%) Gaps:108/313 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SPSQASRRMLSLDQSMLNDDDEENCDTYASG----------GGQNLLVQPEQQQNQAMAQAPPKP 79
            |||....:..:...|....::|.......||          ..:|...:.::..|:     |.||
Human   199 SPSPPGSKSATPSPSSSTQEEESEVHFKISGEKRPSADPGKKAKNPKKKKKKDPNE-----PQKP 258

  Fly    80 LAPFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKREYVRLMRGYR 144
            ::.:|||||||..|||.|||:.:...:..||.:||:||.|.||..|..:.|..|:||::.:..||
Human   259 VSAYALFFRDTQAAIKGQNPSATFGDVSKIVASMWDSLGEEQKQAYKRKTEAAKKEYLKALAAYR 323

  Fly   145 HQLSESEGTSEAEA------PPA--VATNQP----PPLVTTKLESVEDLQ--------------- 182
            ..|.......:.|.      |||  :...||    |.|.:....|  |||               
Human   324 ASLVSKSSPDQGETKSTQANPPAKMLPPKQPMYAMPGLASFLTPS--DLQAFRSGASPASLARTL 386

  Fly   183 ------QSVDAQQEPPPD-----------------QIQLLTE-----------------AARVQ- 206
                  ..:.|...|||.                 |..||:.                 |.:|| 
Human   387 GSKSLLPGLSASPPPPPSFPLSPTLHQQLSLPPHAQGALLSPPVSMSPAPQPPVLPTPMALQVQL 451

  Fly   207 ------------------KCTREQCNKPAIINP----DWEDEYCSNECVVIHC 237
                              ..:...|: |...||    ||:..|.|.||.:..|
Human   452 AMSPSPPGPQDFPHISEFPSSSGSCS-PGPSNPTSSGDWDSSYPSGECGISTC 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12104NP_001261267.1 HMG-box 76..140 CDD:238037 30/63 (48%)
TOX2XP_006723947.1 HMG-box 255..320 CDD:238037 30/64 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9245
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000742
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.