Sequence 1: | NP_001261267.1 | Gene: | CG12104 / 38187 | FlyBaseID: | FBgn0035238 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016880484.1 | Gene: | UBTF / 7343 | HGNCID: | 12511 | Length: | 781 | Species: | Homo sapiens |
Alignment Length: | 202 | Identity: | 36/202 - (17%) |
---|---|---|---|
Similarity: | 89/202 - (44%) | Gaps: | 18/202 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 PSQASRRMLSLDQSMLNDDDEENCDTYASGGGQNLLVQPEQQQNQAMAQAPPKPLAPFALFFRDT 90
Fly 91 VTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKREYVRLMRGYRHQ---LSESEG 152
Fly 153 TSEAEAPPAVATNQPPPLVTTKLESVEDLQQSVDAQQEPPPDQIQLLTEAARVQKCTREQCNK-- 215
Fly 216 --PAIIN 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12104 | NP_001261267.1 | HMG-box | 76..140 | CDD:238037 | 14/63 (22%) |
UBTF | XP_016880484.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5648 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |