DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12104 and TFAM

DIOPT Version :10

Sequence 1:NP_647629.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_003192.1 Gene:TFAM / 7019 HGNCID:11741 Length:246 Species:Homo sapiens


Alignment Length:83 Identity:18/83 - (21%)
Similarity:40/83 - (48%) Gaps:0/83 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 NQAMAQAPPKPLAPFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEK 133
            :..:|..|.||::.:..|.::.:...|.|||.....::...:...|..|.:::|.:|...:..|.
Human    43 SSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEW 107

  Fly   134 REYVRLMRGYRHQLSESE 151
            :.|...:..::.||:.|:
Human   108 QVYKEEISRFKEQLTPSQ 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12104NP_647629.1 HMG-box_SF 78..144 CDD:469606 13/65 (20%)
TFAMNP_003192.1 HMG-box_TFAM_rpt1 50..115 CDD:438802 14/64 (22%)
HMG-box_TFAM_rpt2 135..234 CDD:438803
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.