DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12104 and Hmg20a

DIOPT Version :9

Sequence 1:NP_001261267.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_080088.1 Gene:Hmg20a / 66867 MGIID:1914117 Length:346 Species:Mus musculus


Alignment Length:213 Identity:40/213 - (18%)
Similarity:68/213 - (31%) Gaps:45/213 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PSFGDE----------VFELT--DTPAESQSPSQASRRML-SLDQSMLNDDDEENCDTYASGGGQ 58
            |.|.||          ...||  :.|..|.:.|..:...: .|.|..|...:..|.   ..|..|
Mouse    12 PLFADEDGSKESNDLATSGLTHPEGPYGSAATSTTNPEFVEDLSQGQLLQSEASNA---VEGNEQ 73

  Fly    59 NLLVQPEQQQNQAM---------------AQAPPKPLAPFALFFRDTVTAIKQQNPTCSLEQMQV 108
                :||.:|....               :.||..||..:..|..:....::.:.|.....::..
Mouse    74 ----RPEDEQRSKRGGWSKGRKRKKPLRDSNAPKSPLTGYVRFMNERREQLRAKRPEVPFPEITR 134

  Fly   109 IVQTMWESLDETQKNVYALRHEQEKREYVRLMRGY----------RHQLSESEGTSEAEAPPAVA 163
            ::...|..|...:|..|....:::|..|::.:..|          |......:|.|..:.....|
Mouse   135 MLGNEWSKLPPEEKQRYLDEADRDKERYMKELEQYQKTEAYKVFSRKTQDRQKGKSHRQDAARQA 199

  Fly   164 TNQPPPLVTTKLESVEDL 181
            |:........|..||.|:
Mouse   200 THDHEKETEVKERSVFDI 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12104NP_001261267.1 HMG-box 76..140 CDD:238037 11/63 (17%)
Hmg20aNP_080088.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..112 22/106 (21%)
DUF5401 <76..312 CDD:375164 24/142 (17%)
HMGB-UBF_HMG-box 102..167 CDD:238686 11/64 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..210 5/31 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.