DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12104 and UBTFL1

DIOPT Version :9

Sequence 1:NP_001261267.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001137447.1 Gene:UBTFL1 / 642623 HGNCID:14533 Length:393 Species:Homo sapiens


Alignment Length:164 Identity:30/164 - (18%)
Similarity:64/164 - (39%) Gaps:16/164 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EENCDTYASGGGQNLLVQPEQ--------QQNQAMAQAPPKPLAPFALFFRDTVTAIKQQNPTCS 102
            |.:|:....|..:.|:::.::        |:.:.....|.:||..:..||:::.....|..|...
Human    62 EISCNLRKFGTLKELVLEAKKCVKKMNKSQKYRNGPDFPKRPLTAYNRFFKESWPQYSQMYPGMR 126

  Fly   103 LEQMQVIVQTMWESLDETQKNVYALRHEQEKREYVRLMRGYRHQLSESEGTSEAEAPPAVATNQP 167
            .:::..|:...:..|.|..|..|.....:||:|:...:..:|.:..:....::..:......|:.
Human   127 SQELTKILSKKYRELPEQMKQKYIQDFRKEKQEFEEKLARFREEHPDLVQKAKKSSVSKRTQNKV 191

  Fly   168 PPLVTTKLESVEDLQQS------VDAQQEP--PP 193
            .......:|.|..|.::      |....||  ||
Human   192 QKKFQKNIEEVRSLPKTDRFFKKVKFHGEPQKPP 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12104NP_001261267.1 HMG-box 76..140 CDD:238037 15/63 (24%)
UBTFL1NP_001137447.1 HMGB-UBF_HMG-box 100..165 CDD:238686 15/64 (23%)
HMGB-UBF_HMG-box 223..285 CDD:238686 2/3 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..393
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.