DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12104 and hmgb3a

DIOPT Version :9

Sequence 1:NP_001261267.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001116308.1 Gene:hmgb3a / 561025 ZFINID:ZDB-GENE-050428-1 Length:213 Species:Danio rerio


Alignment Length:180 Identity:36/180 - (20%)
Similarity:75/180 - (41%) Gaps:23/180 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LTDTPAESQSPSQASRRMLSLDQSMLNDDDEENCDTYASGGGQNLLVQPEQQQNQAMAQAPPKPL 80
            :|| ..:|:....|.:..:..||.|::                   ..|.::..:....||.:|.
Zfish    52 MTD-KEKSRFEDMAKQDKVRYDQEMMH-------------------YMPGKRGKKKDPNAPKRPP 96

  Fly    81 APFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKREYVRLMRGYRH 145
            :.|.||..:....||.|.|:..:..:...:..||..|.:..|..:.::..:.|.:|.:.:..|:.
Zfish    97 SGFFLFCSEHRPQIKAQYPSLGIGDVAKKLGEMWNGLTDANKQPFLMKANKLKDKYQKDVADYKT 161

  Fly   146 QLSESEGTSEAEAPPAVATNQPPPLVTTKLESVEDLQQSVDAQQEPPPDQ 195
            : |::.|.|.....|......|.|::.:.::..||.::  |.::|...|:
Zfish   162 K-SKAGGVSMGMGMPMANCMPPKPMMKSNMDDEEDDEE--DEEEEEDDDE 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12104NP_001261267.1 HMG-box 76..140 CDD:238037 15/63 (24%)
hmgb3aNP_001116308.1 HMG_box_2 7..78 CDD:286146 7/45 (16%)
HMG_box 92..159 CDD:278906 15/66 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.