DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12104 and tox3

DIOPT Version :9

Sequence 1:NP_001261267.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_005169075.1 Gene:tox3 / 555286 ZFINID:ZDB-GENE-090312-209 Length:587 Species:Danio rerio


Alignment Length:207 Identity:59/207 - (28%)
Similarity:95/207 - (45%) Gaps:28/207 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LTDTPAESQSPS-QASRRMLSLDQSMLNDDDEENCDTY------ASGGGQNLLVQPE--QQQNQA 71
            :|.:.....||| .||:.......|.:|:||:|..:..      |...|:    :|:  :::.:.
Zfish   199 MTGSNIAHTSPSPPASKSATPSPSSSINEDDQEEGNRVIGEKRPAPDAGK----KPKTPKKKKKK 259

  Fly    72 MAQAPPKPLAPFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKREY 136
            ....|.||::.:|||||||..|||.|||..:..::..||.:||:.|.|.||.||..:.|..|:||
Zfish   260 DPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDGLGEEQKQVYKSKTEAAKKEY 324

  Fly   137 VRLMRGYRHQLSESEGTSEAEA---------------PPAVATNQPPPLVTTKLESVEDLQQSVD 186
            ::.:..||..|........|||               .||:....|.....:...:.:.|||::.
Zfish   325 LKALAAYRASLVSKAAAESAEAQTIRSVQQTLASTSLSPALVLPSPLSQHPSMSAAAQALQQALP 389

  Fly   187 AQQEPPPDQIQL 198
            ....|.|.|:::
Zfish   390 RAIAPKPLQMRV 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12104NP_001261267.1 HMG-box 76..140 CDD:238037 30/63 (48%)
tox3XP_005169075.1 HMG-box 264..329 CDD:238037 30/64 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9262
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000742
OrthoInspector 1 1.000 - - otm25163
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X923
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.