Sequence 1: | NP_001261267.1 | Gene: | CG12104 / 38187 | FlyBaseID: | FBgn0035238 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001028965.1 | Gene: | Ubtfl1 / 546118 | MGIID: | 3588290 | Length: | 394 | Species: | Mus musculus |
Alignment Length: | 185 | Identity: | 38/185 - (20%) |
---|---|---|---|
Similarity: | 67/185 - (36%) | Gaps: | 39/185 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 76 PPKPLAPFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKREYVRLM 140
Fly 141 RGYRHQLSESEGTSEAEAPPAVATNQP----------PPLVTTKLESVEDLQQSVDAQQEP--PP 193
Fly 194 DQIQLLTEAARVQKCTREQCNKPAIIN-----------------PDWEDEYCSNE 231 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12104 | NP_001261267.1 | HMG-box | 76..140 | CDD:238037 | 14/63 (22%) |
Ubtfl1 | NP_001028965.1 | HMGB-UBF_HMG-box | 101..166 | CDD:238686 | 14/64 (22%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 167..197 | 4/29 (14%) | |||
HMGB-UBF_HMG-box | 226..288 | CDD:238686 | 10/58 (17%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 305..394 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5648 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |