DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12104 and tHMG2

DIOPT Version :10

Sequence 1:NP_647629.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001163689.1 Gene:tHMG2 / 42651 FlyBaseID:FBgn0038979 Length:134 Species:Drosophila melanogaster


Alignment Length:159 Identity:36/159 - (22%)
Similarity:57/159 - (35%) Gaps:24/159 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 NTWSNDECNEAVAEVLKQYHEIDIYSIYTSVCIGDSARSSYFDSAQFKTN-SRISSKRMPPRLMG 339
            |.| |...|...|..    ..|:..::..:|.:..|..|.|...:|..|. |::|......||  
  Fly    79 NVW-NSRINTTAACA----RAIERATVKPAVFVNISGVSHYAPGSQKHTELSKVSDYDFMSRL-- 136

  Fly   340 GYDPCLDDYARVFYNRADVQKSLHASDGVNL-KNWSICNMEIFNNWTGSNPSV------LP-IYE 396
                |::.......:...:.:.:....||.| :...:....|...|.|....|      || |:.
  Fly   137 ----CIEWERAATLSDNSICRVVRVRSGVVLGREGGMIQSLILPFWFGLGGPVGDGKHDLPWIHA 197

  Fly   397 KLIAGGLRIWV----YSGDTDGRVPVLAT 421
            ..:.|.:|..:    .||..:|..|.|||
  Fly   198 DDLCGLIRFAIERPEVSGVLNGVAPELAT 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12104NP_647629.1 HMG-box_SF 78..144 CDD:469606
tHMG2NP_001163689.1 HMG-box_SSRP1-like 11..78 CDD:438810
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.