DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12104 and Hmg20b

DIOPT Version :9

Sequence 1:NP_001261267.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_006241006.1 Gene:Hmg20b / 362825 RGDID:1309235 Length:344 Species:Rattus norvegicus


Alignment Length:255 Identity:46/255 - (18%)
Similarity:87/255 - (34%) Gaps:62/255 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 HTPSFGDEVFELTDTPAESQSPSQASRRMLSLDQSMLNDDDEENCDTYASGGGQNLLVQP----- 64
            |.|          |....||||||                            |.:.|:||     
  Rat    55 HAP----------DPAHSSQSPSQ----------------------------GHSPLLQPVKKRG 81

  Fly    65 ---EQQQNQAMAQAPPKPLAPFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYA 126
               .:::.:.:...|..|:..:..|..:....|:.::|.....::..::...|..|...:|..|.
  Rat    82 WPKGKKRKKILPNGPKAPVTGYVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPAEKQRYL 146

  Fly   127 LRHEQEKREYVRLMRGYRHQLSESEGTSEAEAPPAVATNQPPPLVTTKLESVEDLQQSVDAQQEP 191
            ...|:||::|::.:..|:...:....|.:.:.......:....|:.|.|..    .:.||.....
  Rat   147 DEAEKEKQQYLKELWAYQQSEAYKVCTEKIQENKIKKEDSSSGLMNTLLNG----HKGVDCGDGF 207

  Fly   192 PPDQIQLLTEAARVQKCTRE-QCNKPAIINPDWEDEYCSNECVVIHCRNVFNHWVISMNS 250
            ....:.:.||....|...|| :..:...:|..:|::   |..:..|.:        ||||
  Rat   208 STFDVPIFTEEFLDQNKAREAELRRLRKMNVAFEEQ---NAVLQRHTQ--------SMNS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12104NP_001261267.1 HMG-box 76..140 CDD:238037 13/63 (21%)
Hmg20bXP_006241006.1 NHP6B 26..229 CDD:227935 38/215 (18%)
HMGB-UBF_HMG-box 96..160 CDD:238686 13/63 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.