DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12104 and Tox

DIOPT Version :9

Sequence 1:NP_001261267.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001102124.1 Gene:Tox / 362481 RGDID:1310455 Length:525 Species:Rattus norvegicus


Alignment Length:324 Identity:78/324 - (24%)
Similarity:116/324 - (35%) Gaps:118/324 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TDTPAESQSPSQASRRMLSLDQSMLNDDDEENCDTYASGGGQ-----NLLVQPE--QQQNQAMAQ 74
            |:.|..|.||..:.....|...|:..|:.|   ||....||:     ::..:|:  :::.:....
  Rat   198 TNVPHNSPSPPGSKSATPSPSSSVHEDECE---DTSKINGGEKRPASDMGKKPKTPKKKKKKDPN 259

  Fly    75 APPKPLAPFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKREYVRL 139
            .|.||::.:|||||||..|||.|||..:..::..||.:||:.|.|.||.||..:.|..|:||::.
  Rat   260 EPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDGLGEEQKQVYKKKTEAAKKEYLKQ 324

  Fly   140 MRGYRHQL-SESEGTSEAEAPPAVATNQPPPLVTTK----------------------------- 174
            :..||..| |:|...     |..|.|:|||.||.:|                             
  Rat   325 LAAYRASLVSKSYND-----PVDVKTSQPPQLVNSKPSVFHGPSQAHSALYLSSHYHQQPGMTPQ 384

  Fly   175 ------------------------------------LESVEDLQQSVDAQQEPP----------P 193
                                                |:....|.|.:..||..|          |
  Rat   385 LTAMHPSLPRNIAPKPNNQMPVTVSIANMAVSPPPPLQISPPLHQHLSMQQHQPLVQQPLASQLP 449

  Fly   194 DQIQLLTEAARVQKCTREQCNKPAIINP---------------------------DWEDEYCSN 230
            .|:|....:..:|:....|.:...||||                           ||..:|||:
  Rat   450 MQVQTALHSPTMQQGFTLQPDYQTIINPTSTAAQVVTQAMEYVRSGCRNPPPQPVDWSTDYCSS 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12104NP_001261267.1 HMG-box 76..140 CDD:238037 30/63 (48%)
ToxNP_001102124.1 NHP6B <257..>360 CDD:227935 44/107 (41%)
HMG-box 261..>310 CDD:238037 24/48 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9008
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000742
OrthoInspector 1 1.000 - - otm45059
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X923
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.770

Return to query results.
Submit another query.