Sequence 1: | NP_001261267.1 | Gene: | CG12104 / 38187 | FlyBaseID: | FBgn0035238 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001102124.1 | Gene: | Tox / 362481 | RGDID: | 1310455 | Length: | 525 | Species: | Rattus norvegicus |
Alignment Length: | 324 | Identity: | 78/324 - (24%) |
---|---|---|---|
Similarity: | 116/324 - (35%) | Gaps: | 118/324 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 TDTPAESQSPSQASRRMLSLDQSMLNDDDEENCDTYASGGGQ-----NLLVQPE--QQQNQAMAQ 74
Fly 75 APPKPLAPFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKREYVRL 139
Fly 140 MRGYRHQL-SESEGTSEAEAPPAVATNQPPPLVTTK----------------------------- 174
Fly 175 ------------------------------------LESVEDLQQSVDAQQEPP----------P 193
Fly 194 DQIQLLTEAARVQKCTREQCNKPAIINP---------------------------DWEDEYCSN 230 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12104 | NP_001261267.1 | HMG-box | 76..140 | CDD:238037 | 30/63 (48%) |
Tox | NP_001102124.1 | NHP6B | <257..>360 | CDD:227935 | 44/107 (41%) |
HMG-box | 261..>310 | CDD:238037 | 24/48 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 73 | 1.000 | Domainoid score | I9008 |
eggNOG | 1 | 0.900 | - | - | E1_COG5648 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000742 | |
OrthoInspector | 1 | 1.000 | - | - | otm45059 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 1 | 1.000 | - | - | X923 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
8 | 7.770 |