DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12104 and Tox2

DIOPT Version :9

Sequence 1:NP_001261267.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_017447281.1 Gene:Tox2 / 311615 RGDID:735184 Length:561 Species:Rattus norvegicus


Alignment Length:154 Identity:48/154 - (31%)
Similarity:75/154 - (48%) Gaps:6/154 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AESQSPSQASRRMLSLDQSMLNDDDEENCDTYASGGGQNLLVQPEQQQNQAMAQAPPKPLAPFAL 85
            ::|.:||.:|........:......|:...|......:|...:.::..|:     |.||::.:||
  Rat   242 SKSATPSPSSSTQEEESDAHFKISGEKRPSTDPGKKAKNPKKKKKKDPNE-----PQKPVSAYAL 301

  Fly    86 FFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKREYVRLMRGYRHQLSES 150
            |||||..|||.|||:.:...:..||.:||:||.|.||..|..:.|..|:||::.:..||..|...
  Rat   302 FFRDTQAAIKGQNPSATFGDVSKIVASMWDSLGEEQKQAYKRKTEAAKKEYLKALAAYRASLVSK 366

  Fly   151 EGTSEAEAPPAVATNQPPPLVTTK 174
            ....:.||..|.| |.|..::..|
  Rat   367 SPPDQGEAKNAQA-NPPAKMLPPK 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12104NP_001261267.1 HMG-box 76..140 CDD:238037 30/63 (48%)
Tox2XP_017447281.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9008
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000742
OrthoInspector 1 1.000 - - otm45059
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.860

Return to query results.
Submit another query.