DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12104 and Hmgb2

DIOPT Version :10

Sequence 1:NP_647629.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_058883.1 Gene:Hmgb2 / 29395 RGDID:69291 Length:210 Species:Rattus norvegicus


Alignment Length:127 Identity:30/127 - (23%)
Similarity:51/127 - (40%) Gaps:19/127 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 APPKPLAPFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKREYVRL 139
            ||.:|.:.|.||..:....||.::|..|:......:..||.......|..|..:..:.|.:|.:.
  Rat    94 APKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKD 158

  Fly   140 MRGYRHQLSESEGTSE-AEAPPAVAT-----NQPPPLVTTKLESVEDLQQSVDAQQEPPPDQ 195
            :..||     ::|.|| .:..|...|     |:|        |..|:.::..|.:.|...|:
  Rat   159 IAAYR-----AKGKSEVGKKGPGRPTGSKKKNEP--------EDEEEEEEEEDDEDEEEEDE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12104NP_647629.1 HMG-box_SF 78..144 CDD:469606 14/65 (22%)
Hmgb2NP_058883.1 HMG-box_HMGB_rpt1 8..76 CDD:438794
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..102 3/7 (43%)
HMG-box_HMGB_rpt2 93..163 CDD:438795 16/68 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..210 14/59 (24%)
Required for chemotactic activity. /evidence=ECO:0000250|UniProtKB:P26583 165..180 4/14 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.