Sequence 1: | NP_001261267.1 | Gene: | CG12104 / 38187 | FlyBaseID: | FBgn0035238 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_775446.2 | Gene: | Tox4 / 286990 | RGDID: | 708449 | Length: | 619 | Species: | Rattus norvegicus |
Alignment Length: | 447 | Identity: | 91/447 - (20%) |
---|---|---|---|
Similarity: | 134/447 - (29%) | Gaps: | 223/447 - (49%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 PSQASRRMLSLDQSMLNDDDEENCDTYAS--GGGQNLLVQPEQQQNQAMAQ------APPKPLAP 82
Fly 83 FALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKREYVRLMRGYR--H 145
Fly 146 QLSESEGTSEAEAPPAVATNQPPPLVT-------------------------------------- 172
Fly 173 ------TKL-------------------------------------------------------- 175
Fly 176 -------------------------------ESVEDLQQ---------------SVDAQQEPPPD 194
Fly 195 QIQLL---------------------------TEAARVQ-------------------------- 206
Fly 207 --------------KCTREQCNKPAIINPDWEDEYCSNECVVIHCRNVFNHWVISMN 249 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12104 | NP_001261267.1 | HMG-box | 76..140 | CDD:238037 | 31/63 (49%) |
Tox4 | NP_775446.2 | NHP6B | 140..>306 | CDD:227935 | 44/140 (31%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 155..227 | 12/61 (20%) | |||
Nuclear localization signal. /evidence=ECO:0000255 | 213..218 | 0/4 (0%) | |||
HMG-box | 223..288 | CDD:238037 | 31/64 (48%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 304..335 | 7/30 (23%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 436..458 | 0/21 (0%) | |||
PHA03160 | <464..530 | CDD:165431 | 9/65 (14%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 73 | 1.000 | Domainoid score | I9008 |
eggNOG | 1 | 0.900 | - | - | E1_COG5648 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000742 | |
OrthoInspector | 1 | 1.000 | - | - | otm45059 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X923 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 1 | 0.960 | - | - | ||
7 | 6.860 |