DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12104 and Tox4

DIOPT Version :9

Sequence 1:NP_001261267.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_775446.2 Gene:Tox4 / 286990 RGDID:708449 Length:619 Species:Rattus norvegicus


Alignment Length:447 Identity:91/447 - (20%)
Similarity:134/447 - (29%) Gaps:223/447 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PSQASRRMLSLDQSMLNDDDEENCDTYAS--GGGQNLLVQPEQQQNQAMAQ------APPKPLAP 82
            |:|:....||...|..|...|:..|.:..  ...:.::|:..::|.....:      .|.||::.
  Rat   165 PAQSPEDRLSTTPSPTNSLHEDGVDDFRRQLPAQKTVVVETGKKQKAPKKRKKKDPNEPQKPVSA 229

  Fly    83 FALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKREYVRLMRGYR--H 145
            :|||||||..|||.|||..:..::..||.:||:||.|.||.||..:.|..|:||::.:..|:  .
  Rat   230 YALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLKALAAYKDNQ 294

  Fly   146 QLSESEGTSEAEAPPAVATNQPPPLVT-------------------------------------- 172
            :...:..|.|.:..|...|..|||:.|                                      
  Rat   295 ECQATVETVELDPVPQSQTPSPPPVTTADPASPAPASTESPALSPCIVVNSTLSSYVANQASSGP 359

  Fly   173 ------TKL-------------------------------------------------------- 175
                  |||                                                        
  Rat   360 GGQPNITKLIITKQMLPSSITMSQGGMVTVIPATVVTSRGLQLGQTSTATIQPSQQAQIVTRSVL 424

  Fly   176 -------------------------------ESVEDLQQ---------------SVDAQQEPPPD 194
                                           :.|..|||               .::.||:|||.
  Rat   425 QAAAAAAASMQLPPPRLQPPPLQQMPQPPTQQQVTILQQPPPLQAMQQPPPQKVRINLQQQPPPL 489

  Fly   195 QIQLL---------------------------TEAARVQ-------------------------- 206
            |.:::                           .||..|:                          
  Rat   490 QSKIVPPPALKMQATVLPPTVESSPEQPMNSSPEAHTVEATSPETICEMIADVVPEVESPSQMDV 554

  Fly   207 --------------KCTREQCNKPAIINPDWEDEYCSNECVVIHCRNVFNHWVISMN 249
                          :|.|..|..|.:|:.||::|||||||||.|||:||..||.|.|
  Rat   555 ELVSGSPVTLSPQPRCVRSGCENPPVISKDWDNEYCSNECVVKHCRDVFLAWVASRN 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12104NP_001261267.1 HMG-box 76..140 CDD:238037 31/63 (49%)
Tox4NP_775446.2 NHP6B 140..>306 CDD:227935 44/140 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..227 12/61 (20%)
Nuclear localization signal. /evidence=ECO:0000255 213..218 0/4 (0%)
HMG-box 223..288 CDD:238037 31/64 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..335 7/30 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 436..458 0/21 (0%)
PHA03160 <464..530 CDD:165431 9/65 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9008
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000742
OrthoInspector 1 1.000 - - otm45059
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X923
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.860

Return to query results.
Submit another query.