DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12104 and TOX3

DIOPT Version :9

Sequence 1:NP_001261267.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001073899.2 Gene:TOX3 / 27324 HGNCID:11972 Length:576 Species:Homo sapiens


Alignment Length:204 Identity:61/204 - (29%)
Similarity:93/204 - (45%) Gaps:32/204 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PAESQSPSQASRRMLSLDQSMLNDDDEENCD------TYASGGGQNLLVQPE--QQQNQAMAQAP 76
            |..|.|| .||:.......|.:|::|.:..:      ..|...|:    :|:  :::.:.....|
Human   196 PHTSPSP-PASKSATPSPSSSINEEDADEANRAIGEKRAAPDSGK----KPKTPKKKKKKDPNEP 255

  Fly    77 PKPLAPFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKREYVRLMR 141
            .||::.:|||||||..|||.|||..:..::..||.:||:||.|.||.||..:.|..|:||::.:.
Human   256 QKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKKEYLKALA 320

  Fly   142 GYRHQLSESEGTSEAEAPPAVATNQPPPLVTTKL-----------------ESVEDLQQSVDAQQ 189
            .||..|........|||....:..|  .|.:|.|                 .|.:.||||:....
Human   321 AYRASLVSKAAAESAEAQTIRSVQQ--TLASTNLTSSLLLNTPLSQHGTVSASPQTLQQSLPRSI 383

  Fly   190 EPPPDQIQL 198
            .|.|..::|
Human   384 APKPLTMRL 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12104NP_001261267.1 HMG-box 76..140 CDD:238037 31/63 (49%)
TOX3NP_001073899.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..258 13/66 (20%)
HMG-box 255..320 CDD:238037 31/64 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 422..443
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 519..563
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9245
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000742
OrthoInspector 1 1.000 - - otm40922
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X923
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.