Sequence 1: | NP_001261267.1 | Gene: | CG12104 / 38187 | FlyBaseID: | FBgn0035238 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001073899.2 | Gene: | TOX3 / 27324 | HGNCID: | 11972 | Length: | 576 | Species: | Homo sapiens |
Alignment Length: | 204 | Identity: | 61/204 - (29%) |
---|---|---|---|
Similarity: | 93/204 - (45%) | Gaps: | 32/204 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 PAESQSPSQASRRMLSLDQSMLNDDDEENCD------TYASGGGQNLLVQPE--QQQNQAMAQAP 76
Fly 77 PKPLAPFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKREYVRLMR 141
Fly 142 GYRHQLSESEGTSEAEAPPAVATNQPPPLVTTKL-----------------ESVEDLQQSVDAQQ 189
Fly 190 EPPPDQIQL 198 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12104 | NP_001261267.1 | HMG-box | 76..140 | CDD:238037 | 31/63 (49%) |
TOX3 | NP_001073899.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 189..258 | 13/66 (20%) | |
HMG-box | 255..320 | CDD:238037 | 31/64 (48%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 422..443 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 519..563 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 73 | 1.000 | Domainoid score | I9245 |
eggNOG | 1 | 0.900 | - | - | E1_COG5648 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000742 | |
OrthoInspector | 1 | 1.000 | - | - | otm40922 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X923 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.860 |