DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12104 and Tox2

DIOPT Version :9

Sequence 1:NP_001261267.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001359507.1 Gene:Tox2 / 269389 MGIID:3611233 Length:541 Species:Mus musculus


Alignment Length:310 Identity:70/310 - (22%)
Similarity:106/310 - (34%) Gaps:103/310 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AESQSPSQASRRMLSLDQSMLNDDDEENCDTYASGGGQNLLVQP------EQQQNQAMAQAPPKP 79
            ::|.:||.:|           :..:||:...:...|.:...|.|      .:::.:.....|.||
Mouse   222 SKSATPSPSS-----------STQEEESDAHFKISGEKRPSVDPGKKAKNPKKKKKKDPNEPQKP 275

  Fly    80 LAPFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKREYVRLMRGYR 144
            ::.:|||||||..|||.|||:.:...:..||.:||:||.|.||..|..:.|..|:||::.:..||
Mouse   276 VSAYALFFRDTQAAIKGQNPSATFGDVSKIVASMWDSLGEEQKQAYKRKTEAAKKEYLKALAAYR 340

  Fly   145 HQLSESEGTSEAEA------PPA------------------------------------------ 161
            ..|.......:.||      |||                                          
Mouse   341 ASLVSKSPPDQGEAKNTQANPPAKMLPPKQPMYAMPGLASFLTPSDLQAFRSGASPASLARTLGS 405

  Fly   162 ------VATNQPPPLVTTKLESVEDLQQSVDAQ-------------QEPP--PDQIQLLTEAARV 205
                  ::|:.|||.........:.|.....||             .:||  |..:.|..:.|..
Mouse   406 KALLPGLSTSPPPPSFPLSPSLHQQLPLPPHAQGTLLSPPLSMSPAPQPPVLPASMALQVQLAMS 470

  Fly   206 QKCTREQ-------------CNKPAIINP----DWEDEYCSNECVVIHCR 238
            ......|             ...|...||    ||:..|.|.|..:..||
Mouse   471 PSPPGPQDFPHISDFSSGSGSRSPGPSNPSSSGDWDGSYPSGERGLGTCR 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12104NP_001261267.1 HMG-box 76..140 CDD:238037 30/63 (48%)
Tox2NP_001359507.1 HMG-box 272..337 CDD:238037 30/64 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9195
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000742
OrthoInspector 1 1.000 - - otm42995
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4401
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.890

Return to query results.
Submit another query.