DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12104 and Ubtf

DIOPT Version :9

Sequence 1:NP_001261267.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001121162.1 Gene:Ubtf / 25574 RGDID:3927 Length:764 Species:Rattus norvegicus


Alignment Length:202 Identity:36/202 - (17%)
Similarity:89/202 - (44%) Gaps:18/202 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PSQASRRMLSLDQSMLNDDDEENCDTYASGGGQNLLVQPEQQQNQAMAQAPPKPLAPFALFFRDT 90
            |.:..:|:|. ::.|||.:.::.....:.        :|.|:..:..::.|.:|::...:|..:.
  Rat   366 PEEEQQRVLG-EEKMLNINKKQTTSPASK--------KPSQEGGKGGSEKPKRPVSAMFIFSEEK 421

  Fly    91 VTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKREYVRLMRGYRH---QLSESEG 152
            ...::::.|..|..::..::..||..|.|.:|..|..|....|.:..|...|.|.   :|.||..
  Rat   422 RRQLQEERPELSESELTRLLARMWNDLSEKKKAKYKAREAALKAQSERKPGGEREDRGKLPESPK 486

  Fly   153 TSEAEAPPAVATNQPPPLVTTKLESVEDLQQSVDAQQEPPPDQIQLLTEAARVQKCTREQCNK-- 215
            .:|.....:|..:........::::::.::.:.:..::  .:::..:.:||..||....:.::  
  Rat   487 RAEEIWQQSVIGDYLARFKNDRVKALKAMEMTWNNMEK--KEKLMWIKKAAEDQKRYERELSEMR 549

  Fly   216 --PAIIN 220
              ||..|
  Rat   550 APPAATN 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12104NP_001261267.1 HMG-box 76..140 CDD:238037 14/63 (22%)
UbtfNP_001121162.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
HMG_box 112..179 CDD:395407
HMGB-UBF_HMG-box 196..261 CDD:238686
HMGB-UBF_HMG-box 299..358 CDD:238686
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 370..411 8/49 (16%)
HMGB-UBF_HMG-box 407..470 CDD:238686 13/62 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 456..488 9/31 (29%)
HMG_box_5 479..562 CDD:373364 12/80 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 546..576 3/11 (27%)
HMGB-UBF_HMG-box 569..631 CDD:238686
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 648..764
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.