Sequence 1: | NP_001261267.1 | Gene: | CG12104 / 38187 | FlyBaseID: | FBgn0035238 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001121162.1 | Gene: | Ubtf / 25574 | RGDID: | 3927 | Length: | 764 | Species: | Rattus norvegicus |
Alignment Length: | 202 | Identity: | 36/202 - (17%) |
---|---|---|---|
Similarity: | 89/202 - (44%) | Gaps: | 18/202 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 PSQASRRMLSLDQSMLNDDDEENCDTYASGGGQNLLVQPEQQQNQAMAQAPPKPLAPFALFFRDT 90
Fly 91 VTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKREYVRLMRGYRH---QLSESEG 152
Fly 153 TSEAEAPPAVATNQPPPLVTTKLESVEDLQQSVDAQQEPPPDQIQLLTEAARVQKCTREQCNK-- 215
Fly 216 --PAIIN 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12104 | NP_001261267.1 | HMG-box | 76..140 | CDD:238037 | 14/63 (22%) |
Ubtf | NP_001121162.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..21 | ||
HMG_box | 112..179 | CDD:395407 | |||
HMGB-UBF_HMG-box | 196..261 | CDD:238686 | |||
HMGB-UBF_HMG-box | 299..358 | CDD:238686 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 370..411 | 8/49 (16%) | |||
HMGB-UBF_HMG-box | 407..470 | CDD:238686 | 13/62 (21%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 456..488 | 9/31 (29%) | |||
HMG_box_5 | 479..562 | CDD:373364 | 12/80 (15%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 546..576 | 3/11 (27%) | |||
HMGB-UBF_HMG-box | 569..631 | CDD:238686 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 648..764 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5648 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |