DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12104 and Tox3

DIOPT Version :9

Sequence 1:NP_001261267.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_766501.2 Gene:Tox3 / 244579 MGIID:3039593 Length:575 Species:Mus musculus


Alignment Length:341 Identity:74/341 - (21%)
Similarity:112/341 - (32%) Gaps:148/341 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FHTPSFGDEVFEL--TDTPAESQS------------------PSQASR------------RMLSL 36
            |||||.|||.||:  ...|.||..                  |||.:.            ..:::
Mouse    53 FHTPSLGDEEFEIPPITPPPESDPTLGMPDALLPFQTLSDPLPSQGTEFTPQFPPQSLDLPSITI 117

  Fly    37 DQSMLNDD----------DEENCD---------------TYASGGGQNLLVQPEQ----QQNQAM 72
            .::::..|          |:.:..               .:.:.|.::.::.|.|    .|:|..
Mouse   118 SRNLVEQDGVLHSNGLHMDQSHTQVSQYRQDPSLVMRSIVHMTDGARSGIMPPAQLTTINQSQLS 182

  Fly    73 AQ---------------APP--------------------------------------------- 77
            ||               :||                                             
Mouse   183 AQLGLNLGGANVSHTSPSPPASKSATPSPSSSINEEDADDANRAIGEKRTAPDSGKKPKTPKKKK 247

  Fly    78 --------KPLAPFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKR 134
                    ||::.:|||||||..|||.|||..:..::..||.:||:||.|.||.||..:.|..|:
Mouse   248 KKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQKQVYKRKTEAAKK 312

  Fly   135 EYVRLMRGYRHQLSESEGTSEAEAPPAVATNQPPPLVTTKL-----------------ESVEDLQ 182
            ||::.:..||..|........|||....:..|  .|.:|.|                 .|.:.|.
Mouse   313 EYLKALAAYRASLVSKAAAESAEAQTIRSVQQ--TLASTNLTSSLLLNTSLSQHGTVPASPQTLP 375

  Fly   183 QSVDAQQEPPPDQIQL 198
            ||:.....|.|..::|
Mouse   376 QSLPRSIAPKPLTMRL 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12104NP_001261267.1 HMG-box 76..140 CDD:238037 32/116 (28%)
Tox3NP_766501.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 189..258 3/68 (4%)
HMG-box 254..319 CDD:238037 30/64 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 516..575
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9195
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000742
OrthoInspector 1 1.000 - - otm42995
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X923
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.860

Return to query results.
Submit another query.