DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12104 and hmg-6

DIOPT Version :9

Sequence 1:NP_001261267.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_493451.2 Gene:hmg-6 / 185946 WormBaseID:WBGene00009827 Length:128 Species:Caenorhabditis elegans


Alignment Length:85 Identity:24/85 - (28%)
Similarity:40/85 - (47%) Gaps:8/85 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 YASGGGQNLLVQPEQQQNQAMAQAPPK--PLAPFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMW 114
            :.:||..|      .:|.|.|.|...|  ..:.:|||||:..:..|:..|..:..|:...:...|
 Worm    29 WLTGGNSN------SRQIQEMDQKKKKIRSTSAYALFFRERQSLEKRAAPYATFGQISQKIARQW 87

  Fly   115 ESLDETQKNVYALRHEQEKR 134
            :||.|.:|..|..|.|:.::
 Worm    88 DSLTEEEKKAYKQRCEKNRK 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12104NP_001261267.1 HMG-box 76..140 CDD:238037 17/61 (28%)
hmg-6NP_493451.2 HMG-box 51..107 CDD:238037 16/55 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000742
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4401
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.