DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12104 and B0238.11

DIOPT Version :9

Sequence 1:NP_001261267.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_504410.1 Gene:B0238.11 / 178915 WormBaseID:WBGene00015075 Length:317 Species:Caenorhabditis elegans


Alignment Length:259 Identity:49/259 - (18%)
Similarity:103/259 - (39%) Gaps:84/259 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PAESQSPSQASRRMLSLDQSMLNDDDEENCDTYASGGGQNLLVQPEQQQNQAMAQA--PPKPLAP 82
            ||...|.|:.             :|.||...|:         .:.|:.:|:...||  .|..:.|
 Worm    35 PAADSSDSEP-------------EDFEEEQITH---------TEAEETRNEDNGQAIYEPDVMRP 77

  Fly    83 FALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQK--NVYALRHEQEKREYVRLMRGYRH 145
            ....|.:.:  :::|:.|.::..|:..| ..|.   ||::  |:.|.....:.|:|::....:::
 Worm    78 LIESFLEFL--VQRQSETSTVHNMENKV-AEWA---ETRRDDNIDAGLFVLDFRKYLKSAVKFKN 136

  Fly   146 -QLSES-----------EGTSEAEAPPAVATNQPPPLVTTKL----------------ESVEDLQ 182
             |:::|           :...|.::.|    ::||    ||:                |.:::..
 Worm   137 LQMNDSCAAISTYLNSEKSLVEYKSMP----DRPP----TKIQLYIKKHQIMLKGIGGEPMKNAY 193

  Fly   183 QSVDAQQEPPPDQIQLLTEAA-----RVQK-------CTREQ----CNKPAIINPDWEDEYCSN 230
            ::::|..|...:..:||.||:     ::|:       .|.||    .||..::|..:..:..|:
 Worm   194 KAMNADTEGAKELDELLREASLQYIPQLQEFLDTHPNLTEEQKRSIVNKMKMLNKKYNSKEISS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12104NP_001261267.1 HMG-box 76..140 CDD:238037 14/65 (22%)
B0238.11NP_504410.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.