DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12104 and Dsp1

DIOPT Version :9

Sequence 1:NP_001261267.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster


Alignment Length:132 Identity:31/132 - (23%)
Similarity:47/132 - (35%) Gaps:29/132 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 APPKPLAPFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKREYVRL 139
            ||.:.|:.|..|..|....:|..||...:..:...:...|..:|...|..|....|::|..|.|.
  Fly   274 APKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERDKARYERE 338

  Fly   140 MRGYRHQLSESEGTSEAEAPPAVATNQPPPLVTTKLESVEDLQQSVDAQQEPPPDQIQLLTEAAR 204
            |..|:     :.|.....||                    .:|.|:.||.:    :..||..||:
  Fly   339 MTEYK-----TSGKIAMSAP--------------------SMQASMQAQAQ----KAALLAAAAQ 374

  Fly   205 VQ 206
            .|
  Fly   375 QQ 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12104NP_001261267.1 HMG-box 76..140 CDD:238037 16/63 (25%)
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061
HMGB-UBF_HMG-box 275..339 CDD:238686 16/63 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.