Sequence 1: | NP_001261267.1 | Gene: | CG12104 / 38187 | FlyBaseID: | FBgn0035238 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_012820733.2 | Gene: | tox / 100488835 | XenbaseID: | XB-GENE-1019590 | Length: | 561 | Species: | Xenopus tropicalis |
Alignment Length: | 322 | Identity: | 74/322 - (22%) |
---|---|---|---|
Similarity: | 117/322 - (36%) | Gaps: | 113/322 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 AESQSPSQASRRMLSLDQSMLNDDDEENCDTYASGG----GQNLLVQPE--QQQNQAMAQAPPKP 79
Fly 80 LAPFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKREYVRLMRGYR 144
Fly 145 HQL-SES-----------------------EGTSEAEAP---------------------PAVAT 164
Fly 165 N--------------------QPPPLVTTKLESVEDLQQSVDAQQEPP-------PDQIQL---- 198
Fly 199 -----------------------LTEAARV----QKCTREQCNKPAIINPDWEDEYCSNECV 233 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12104 | NP_001261267.1 | HMG-box | 76..140 | CDD:238037 | 30/63 (48%) |
tox | XP_012820733.2 | HMG-box | 272..>321 | CDD:238037 | 24/48 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 71 | 1.000 | Domainoid score | I9255 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 105 | 1.000 | Inparanoid score | I4807 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000742 | |
OrthoInspector | 1 | 1.000 | - | - | otm48119 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X923 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
6 | 6.050 |