DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12104 and tox

DIOPT Version :9

Sequence 1:NP_001261267.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_012820733.2 Gene:tox / 100488835 XenbaseID:XB-GENE-1019590 Length:561 Species:Xenopus tropicalis


Alignment Length:322 Identity:74/322 - (22%)
Similarity:117/322 - (36%) Gaps:113/322 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AESQSPSQASRRMLSLDQSMLNDDDEENCDTYASGG----GQNLLVQPE--QQQNQAMAQAPPKP 79
            |...|||....:..:...|....:||.:.::..||.    ..::..:|:  :::.:.....|.||
 Frog   211 AAHNSPSPPGSKSATPSPSSSVHEDEADDNSKISGAEKRPAPDMGKKPKTPKKKKKKDPNEPQKP 275

  Fly    80 LAPFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKREYVRLMRGYR 144
            ::.:|||||||..|||.|||..:..::..||.:||:.|.|.||.||..:.|..|:||::.:..||
 Frog   276 VSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDGLGEEQKQVYKKKTEAAKKEYLKQLAAYR 340

  Fly   145 HQL-SES-----------------------EGTSEAEAP---------------------PAVAT 164
            ..| |:|                       .||::|.:.                     |.:..
 Frog   341 ASLVSKSYSDPVDVKAPQPSQMMNAKAPVFHGTTQAHSTLYLNSPYHQQTAISPHLSAMHPGINR 405

  Fly   165 N--------------------QPPPLVTTKLESVEDLQQSVDAQQEPP-------PDQIQL---- 198
            |                    .|||    .|:....|.|.:..||..|       .:|:|:    
 Frog   406 NIAPKPSNQMPVTVSLASMAVSPPP----SLQMSPPLHQHLHMQQHQPFSMQQSIGNQLQMQGQT 466

  Fly   199 -----------------------LTEAARV----QKCTREQCNKPAIINPDWEDEYCSNECV 233
                                   .:.||:|    .:..|..|..|.....:|.::||||.||
 Frog   467 SLHSPAMQQGFSLQSEYQNLISPTSTAAQVVTQAMEYVRSGCRNPPGQTVEWNNDYCSNGCV 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12104NP_001261267.1 HMG-box 76..140 CDD:238037 30/63 (48%)
toxXP_012820733.2 HMG-box 272..>321 CDD:238037 24/48 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I9255
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 105 1.000 Inparanoid score I4807
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000742
OrthoInspector 1 1.000 - - otm48119
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X923
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.050

Return to query results.
Submit another query.