DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12104 and tox3

DIOPT Version :9

Sequence 1:NP_001261267.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001121484.1 Gene:tox3 / 100158584 XenbaseID:XB-GENE-5887160 Length:580 Species:Xenopus tropicalis


Alignment Length:207 Identity:62/207 - (29%)
Similarity:94/207 - (45%) Gaps:32/207 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TDTPAESQSPSQASRRMLSLDQSMLNDDDEENCD------TYASGGGQNLLVQPE--QQQNQAMA 73
            |..|..|.|| .||:.......|.:||:|.:..:      ..|...|:    :|:  :::.:...
 Frog   195 TAIPHTSPSP-PASKSATPSPSSSVNDEDVDETNRTIGEKRAAPDSGK----KPKTPKKKKKKDP 254

  Fly    74 QAPPKPLAPFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKREYVR 138
            ..|.||::.:|||||||..|||.|||..:..::..||.:||:.|.|.||.||..:.|..|:||::
 Frog   255 NEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDGLGEEQKQVYKRKTEAAKKEYLK 319

  Fly   139 LMRGYRHQLSESEGTSEAEAPPAVATNQPPPLVTTKLESV-----------------EDLQQSVD 186
            .:..||..|........|||....:..|  .|.:|.|.|.                 ::||||:.
 Frog   320 ALAAYRASLVSKAAAESAEAQTIRSVQQ--TLASTNLSSTLLLNTSLSQHAAVSVASQNLQQSIP 382

  Fly   187 AQQEPPPDQIQL 198
            ....|.|..::|
 Frog   383 RAIAPKPLTMRL 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12104NP_001261267.1 HMG-box 76..140 CDD:238037 30/63 (48%)
tox3NP_001121484.1 HMG-box 257..322 CDD:238037 30/64 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I9255
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 105 1.000 Inparanoid score I4807
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000742
OrthoInspector 1 1.000 - - otm48119
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X923
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.