Sequence 1: | NP_001261267.1 | Gene: | CG12104 / 38187 | FlyBaseID: | FBgn0035238 | Length: | 250 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_004918576.1 | Gene: | tox2 / 100124824 | XenbaseID: | XB-GENE-982431 | Length: | 507 | Species: | Xenopus tropicalis |
Alignment Length: | 311 | Identity: | 75/311 - (24%) |
---|---|---|---|
Similarity: | 121/311 - (38%) | Gaps: | 97/311 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 SPSQASRRMLSLDQSMLNDDDEENCDTYASGGGQ-----NLLVQPEQQQNQAM--AQAPPKPLAP 82
Fly 83 FALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKREYVRLMRGYRHQL 147
Fly 148 -----SESEGTSEAEA--------PPAVATNQPPP-----------LVTTKLESV-----EDLQQ 183
Fly 184 SVDAQ--------QEPPPDQI-------------QLLTEAARVQKCTREQCNKPAII-------- 219
Fly 220 ------------------------------NPDWEDEYCSNECVVIHCRNV 240 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12104 | NP_001261267.1 | HMG-box | 76..140 | CDD:238037 | 30/63 (48%) |
tox2 | XP_004918576.1 | HMG-box | 246..311 | CDD:238037 | 30/64 (47%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 71 | 1.000 | Domainoid score | I9255 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 105 | 1.000 | Inparanoid score | I4807 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000742 | |
OrthoInspector | 1 | 1.000 | - | - | otm48119 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R4401 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 5.080 |