DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12104 and tox2

DIOPT Version :9

Sequence 1:NP_001261267.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster
Sequence 2:XP_004918576.1 Gene:tox2 / 100124824 XenbaseID:XB-GENE-982431 Length:507 Species:Xenopus tropicalis


Alignment Length:311 Identity:75/311 - (24%)
Similarity:121/311 - (38%) Gaps:97/311 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SPSQASRRMLSLDQSMLNDDDEENCDTYASGGGQ-----NLLVQPEQQQNQAM--AQAPPKPLAP 82
            |||....:  |...|..:...||..:::..|.|:     :|..:|:.|:.:..  ...|.||::.
 Frog   190 SPSPPGSK--SATPSPSSSTQEEETESHYKGAGEKRPSNDLGKKPKNQKKKKKKDPNEPQKPVSA 252

  Fly    83 FALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQKNVYALRHEQEKREYVRLMRGYRHQL 147
            :|||||||..|||.|||..:...:..||.:||:||.|.||..|..:.|..|:||::.:..||..|
 Frog   253 YALFFRDTQAAIKGQNPNATFGDVSKIVASMWDSLGEEQKQAYKRKTEAAKKEYLKALAAYRASL 317

  Fly   148 -----SESEGTSEAEA--------PPAVATNQPPP-----------LVTTKLESV-----EDLQQ 183
                 ||...|..::|        |.....|.||.           |..|.|:|.     ..|.:
 Frog   318 VSKSYSEQGDTKNSQANQASKMILPKQSMYNLPPQSSSPYPGLASFLSPTDLQSYRGHPHSGLSR 382

  Fly   184 SVDAQ--------QEPPPDQI-------------QLLTEAARVQKCTREQCNKPAII-------- 219
            :::|:        ..|||.||             .||.::..:|:..:.....|::.        
 Frog   383 TLNAKSMLPSISASPPPPFQISPPLHQHLRHPPSSLLNQSLNMQQVPQPPILSPSMALQSPMSSS 447

  Fly   220 ------------------------------NPDWEDEYCSNECVVIHCRNV 240
                                          ||:|::|:.:.||.:..|.::
 Frog   448 PTGQQDFSHLPSEFQSSVGPRSPTSSNPPGNPEWDNEFPNRECGINPCSSL 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12104NP_001261267.1 HMG-box 76..140 CDD:238037 30/63 (48%)
tox2XP_004918576.1 HMG-box 246..311 CDD:238037 30/64 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I9255
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 105 1.000 Inparanoid score I4807
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000742
OrthoInspector 1 1.000 - - otm48119
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4401
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.080

Return to query results.
Submit another query.