DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12104 and tox4b

DIOPT Version :9

Sequence 1:NP_001261267.1 Gene:CG12104 / 38187 FlyBaseID:FBgn0035238 Length:250 Species:Drosophila melanogaster
Sequence 2:NP_001121758.1 Gene:tox4b / 100003353 ZFINID:ZDB-GENE-080220-49 Length:583 Species:Danio rerio


Alignment Length:398 Identity:94/398 - (23%)
Similarity:132/398 - (33%) Gaps:177/398 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SQSPSQASRRMLSLDQSMLNDDDEEN------CDTYASGGGQNLLVQ-----PEQQQNQAMA--- 73
            ||||.|:.....|...| |:|||.::      .|:..|....:.::.     |:|....|.:   
Zfish   175 SQSPEQSMSATGSPSDS-LHDDDMDDFRRSVLVDSPVSLSVSSAVLSVSPSLPDQPVFPASSAVP 238

  Fly    74 ----------------QAPPKPLAPFALFFRDTVTAIKQQNPTCSLEQMQVIVQTMWESLDETQK 122
                            ..|.||::.:|||||||..|||.|||..:..::..||.:||:||.|.||
Zfish   239 VRKPAGGKKGRKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQK 303

  Fly   123 NVYALRHEQEKREYVRLMRGYR-HQLSE------------------------------------- 149
            .||..:.|..|.||::.:..|: .|||:                                     
Zfish   304 QVYKRKAEAAKTEYLKALAAYKAEQLSQPTIEVLDAPPSPPPAAPPAAPPPTPQHRSSRIPVHAP 368

  Fly   150 ---------------------SEGTSEAEAPPAVATNQPPPLVTTKLESVEDLQ--------QSV 185
                                 :...:.|..|||.....|||.||..:.|.:.||        |.:
Zfish   369 NNNTITNICTSNIILDVPQVTTRSRTGAHKPPAPPPAPPPPTVTKIIISKQHLQAQRAPPPLQQM 433

  Fly   186 DA-------QQ-----------------EPPPDQIQLLTEAARVQK------------------- 207
            .|       ||                 .|||.||::|..|.:.::                   
Zfish   434 QATPPPPRLQQMQAPPPLQAKPRQTLASAPPPLQIKILPAAPQSERRLPIILGAGEEHSPAEAVM 498

  Fly   208 ------------------------------------CTREQCNKPAIINPDWEDEYCSNECVVIH 236
                                                |.|..|..|.:.:.||:.||||||||..|
Zfish   499 DTPSPSAADDLAEDAMEVELNVSPAPESSRSDAPGVCVRAGCTNPPVESKDWDREYCSNECVATH 563

  Fly   237 CRNVFNHW 244
            ||:||..|
Zfish   564 CRDVFMAW 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12104NP_001261267.1 HMG-box 76..140 CDD:238037 31/63 (49%)
tox4bNP_001121758.1 HMG-box 257..322 CDD:238037 31/64 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 72 1.000 Domainoid score I9262
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000742
OrthoInspector 1 1.000 - - otm25163
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X923
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.