DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13917 and KLHL6

DIOPT Version :9

Sequence 1:NP_001189017.1 Gene:CG13917 / 38186 FlyBaseID:FBgn0035237 Length:2019 Species:Drosophila melanogaster
Sequence 2:NP_569713.2 Gene:KLHL6 / 89857 HGNCID:18653 Length:621 Species:Homo sapiens


Alignment Length:584 Identity:107/584 - (18%)
Similarity:194/584 - (33%) Gaps:161/584 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly  1063 SLPNGMTLEQVQGQQVDYIQTDLSADSSLASSFSRSGMDESSLSCRQPRRLGEDLLKMFLQEIAT 1127
            |...|..:|.:.|::|.:                    |::.||.....  |.:.|:|  :...|
Human    32 SQKTGDLVEILNGEKVKF--------------------DDAGLSLILQN--GLETLRM--ENALT 72

  Fly  1128 DMLVEVHGRRIRAHKCILRSRCQYFAAMLAGHGSQSV---VSLQGYSYAAVHFALCHIY-SGASH 1188
            |:::.|..:....|:.:|.:...||.||......:..   :.::|.....:|..|.:.| |.|..
Human    73 DVILCVDIQEFSCHRVVLAAASNYFRAMFCNDLKEKYEKRIIIKGVDAETMHTLLDYTYTSKALI 137

  Fly  1189 PPDGIS-LMELAALADLLGL-EGLKEVTAHALKTNYCHNFHKPCSGCSDGILQVLPVALNHALDD 1251
            ....:. ::|.|.|...|.: :........||....|              :.:|.:|..|:||.
Human   138 TKQNVQRVLEAANLFQFLRMVDACASFLTEALNPENC--------------VGILRLADTHSLDS 188

  Fly  1252 LYRKCLRWTCRHYLKVWPTRQFAQLPPDILGRCRQQIVAYMTSDT-VLDTVLDCDHLLAQLSAYR 1315
            |.::...:..::::::..:.:|..||.|.|....:....|:|.:. |.:||:.            
Human   189 LKKQVQSYIIQNFVQILNSEEFLDLPVDTLHHILKSDDLYVTEEAQVFETVMS------------ 241

  Fly  1316 W------------GHVCEQLVREILEAAYAYVGDHFASLIASDSFLSLGHDRSRHIPRLETLLLH 1368
            |            .:|.|.:...:|:..|      |...:.:|..:       |..|.:..||  
Human   242 WVRHKPSERLCLLPYVLENVRLPLLDPWY------FVETVEADPLI-------RQCPEVFPLL-- 291

  Fly  1369 TAAELTPEQACRSYQRVTRLNTVLQAKVIHMPASLGQSELARELQGLQEEQLDWQPEYIRLVGAL 1433
                    |..|.|.                   |..:|:..|  ..:....::|.|...::|. 
Human   292 --------QEARMYH-------------------LSGNEIISE--RTKPRMHEFQSEVFMIIGG- 326

  Fly  1434 VYAVEQCLIRQCSRAMRVTAWQRMDLELRKKIQTLARLTEPL---DMKRQNGKPV--------GK 1487
                       |::..|..|.......||:....:|:|  ||   :::.:|.|.|        .:
Human   327 -----------CTKDERFVAEVTCLDPLRRSRLEVAKL--PLTEHELESENKKWVEFACVTLKNE 378

  Fly  1488 AFSFGGSTRSQDLVQIKLAIQAQTKRANAQETLMYKATQTQDAAGGAGHVQTADRGVQANHESRE 1552
            .:..||.....|:.:...:|   .|....:...:.:........||..:|.....|:|.      
Human   379 VYISGGKETQHDVWKYNSSI---NKWIQIEYLNIGRWRHKMVVLGGKVYVIGGFDGLQR------ 434

  Fly  1553 GGSKLLKSNSRAYVP-HRASSQVATERNSLNLHRRTQSEAPPVTHKKPITVAASTVESKSAQGK 1615
                  .:|...|.| |...|:.|    .|.:|   .|.....:|||.:.|.......|.|..|
Human   435 ------INNVETYDPFHNCWSEAA----PLLVH---VSSFAATSHKKKLYVIGGGPNGKLATDK 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13917NP_001189017.1 BTB 1117..>1185 CDD:279045 15/71 (21%)
BTB 1128..>1191 CDD:197585 14/66 (21%)
BACK 1238..>1281 CDD:197943 10/42 (24%)
KLHL6NP_569713.2 BTB 62..165 CDD:279045 21/104 (20%)
BTB 73..165 CDD:197585 18/91 (20%)
BACK 174..276 CDD:285009 23/133 (17%)
Kelch 1 320..367 11/60 (18%)
KELCH repeat 370..407 CDD:276965 5/39 (13%)
Kelch 2 378..421 5/45 (11%)
KELCH repeat 411..455 CDD:276965 11/59 (19%)
Kelch 422..468 CDD:128874 13/64 (20%)
Kelch 3 422..468 13/64 (20%)
KELCH repeat 458..504 CDD:276965 8/28 (29%)
Kelch_1 459..503 CDD:279660 8/27 (30%)
Kelch 4 470..516 4/16 (25%)
KELCH repeat 506..546 CDD:276965
Kelch 517..558 CDD:128874
Kelch 5 517..558
KELCH repeat 548..593 CDD:276965
Kelch 6 560..606
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.