DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13917 and KLHL12

DIOPT Version :9

Sequence 1:NP_001189017.1 Gene:CG13917 / 38186 FlyBaseID:FBgn0035237 Length:2019 Species:Drosophila melanogaster
Sequence 2:XP_011508137.1 Gene:KLHL12 / 59349 HGNCID:19360 Length:623 Species:Homo sapiens


Alignment Length:578 Identity:112/578 - (19%)
Similarity:190/578 - (32%) Gaps:187/578 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1081 IQTDLSADSSLASSFSRSGMDESSLSCRQPRRLGEDLLKMFLQEIATDMLVEVHGRRIRAHKCIL 1145
            |.|:..|.|.|.   |.:.:.:|:..|                    |:.:.|..:...||:.:|
Human    65 IMTNTHAKSILN---SMNSLRKSNTLC--------------------DVTLRVEQKDFPAHRIVL 106

  Fly  1146 RSRCQYFAAMLAGHGSQS---VVSLQGYSYAAVHFALCHIYSGASHPPDGISLMELAALADLLGL 1207
            .:...||.||.....|:.   .|.:||.:.:.:...|..:|:...|.... ::.||...|.||.|
Human   107 AACSDYFCAMFTSELSEKGKPYVDIQGLTASTMEILLDFVYTETVHVTVE-NVQELLPAACLLQL 170

  Fly  1208 EGLKEVTAHALKTNYCHNFHKPCSGCSDGILQVLPVALNHALDDLYRKCLRWTCRHYLKVWPTRQ 1272
            :|:|:.....|::..     .| |.|    |.:...|..|...||.:....::.:|:.:|....:
Human   171 KGVKQACCEFLESQL-----DP-SNC----LGIRDFAETHNCVDLMQAAEVFSQKHFPEVVQHEE 225

  Fly  1273 FAQLPPDILGRCRQQIVAYMTSDTVLDTVLDCDHLLAQLSAYRWGHVCEQLVRE--ILEAAYAYV 1335
            |..|                 |...::.::.||.:              |:..|  :.||...:|
Human   226 FILL-----------------SQGEVEKLIKCDEI--------------QVDSEEPVFEAVINWV 259

  Fly  1336 GDHFASLIASDSFLSLGHDRSRHIPRLETLLLHTAAE-LTPEQ---------------ACRSYQR 1384
                            .|.:......|..||.:.... |||..               .||    
Human   260 ----------------KHAKKEREESLPNLLQYVRMPLLTPRYITDVIDAEPFIRCSLQCR---- 304

  Fly  1385 VTRLNTVLQAKVIHMPASLGQSELARELQGLQEEQLDWQPEYIRLVGAL------VYAVEQ---- 1439
                :.|.:||..|:     :.||..::||.:........|.:.:||..      :..||:    
Human   305 ----DLVDEAKKFHL-----RPELRSQMQGPRTRARLGANEVLLVVGGFGSQQSPIDVVEKYDPK 360

  Fly  1440 ----CLIRQCSRAMRVTAWQRMDLELRKKIQTL------ARLT--EPLDMKR-QNG-----KPVG 1486
                ..:...:|..|..|    .:.|..:|..:      :||:  |.||... ::|     .|:.
Human   361 TQEWSFLPSITRKRRYVA----SVSLHDRIYVIGGYDGRSRLSSVECLDYTADEDGVWYSVAPMN 421

  Fly  1487 KAFSFGGSTRSQDLVQIKLAIQAQTKRANAQETLMYKATQTQDAAGGAGHVQTADRGVQANHESR 1551
            ......|:|...|::.:.....     .:.:.|.|.:.....|.....|.:|||          |
Human   422 VRRGLAGATTLGDMIYVSGGFD-----GSRRHTSMERYDPNIDQWSMLGDMQTA----------R 471

  Fly  1552 EGGSKLLKS---------------NS-RAYVPHRAS----SQVATERNS-----LNLH 1584
            ||...::.|               || ..|.||...    :.:||:|:.     ||.|
Human   472 EGAGLVVASGVIYCLGGYDGLNILNSVEKYDPHTGHWTNVTPMATKRSGAGVALLNDH 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13917NP_001189017.1 BTB 1117..>1185 CDD:279045 15/70 (21%)
BTB 1128..>1191 CDD:197585 16/65 (25%)
BACK 1238..>1281 CDD:197943 9/42 (21%)
KLHL12XP_011508137.1 BTB 78..181 CDD:279045 26/123 (21%)
PHA03098 101..556 CDD:222983 102/519 (20%)
BACK 190..291 CDD:285009 25/151 (17%)
KELCH repeat 329..370 CDD:276965 5/40 (13%)
Kelch 337..384 CDD:128874 8/50 (16%)
KELCH repeat 374..420 CDD:276965 10/49 (20%)
Kelch 385..434 CDD:128874 10/48 (21%)
KELCH repeat 424..467 CDD:276965 7/47 (15%)
Kelch 436..481 CDD:128874 10/59 (17%)
KELCH repeat 471..514 CDD:276965 9/42 (21%)
Kelch 482..528 CDD:128874 9/45 (20%)
KELCH repeat 518..562 CDD:276965 4/12 (33%)
Kelch 529..575 CDD:128874 1/1 (100%)
KELCH repeat 565..610 CDD:276965
Kelch 576..620 CDD:128874
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.