DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13917 and KLHL24

DIOPT Version :9

Sequence 1:NP_001189017.1 Gene:CG13917 / 38186 FlyBaseID:FBgn0035237 Length:2019 Species:Drosophila melanogaster
Sequence 2:NP_001336342.1 Gene:KLHL24 / 54800 HGNCID:25947 Length:625 Species:Homo sapiens


Alignment Length:324 Identity:64/324 - (19%)
Similarity:128/324 - (39%) Gaps:74/324 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1073 VQGQQVDYIQTDLSADSSLASSFSRSGMDESSLSCRQ------PRRLGEDLLKMFLQ----EIAT 1127
            :.|::::  :.||....|.|:......||..||:..:      .....|::|::|.:    .:.|
Human     4 ILGRRLN--REDLGVRDSPATKRKVFEMDPKSLTGHEFFDFSSGSSHAENILQIFNEFRDSRLFT 66

  Fly  1128 DMLVEVHGRRIRAHKCILRSRCQYFAAMLAGHGSQS---VVSLQGYSYAAVHFALCHIYSG---- 1185
            |:::.|.|:....|:.:|.:...||.||......:|   :|.:.|....|:...|.::|:|    
Human    67 DVIICVEGKEFPCHRAVLSACSSYFRAMFCNDHRESREMLVEINGILAEAMECFLQYVYTGKVKI 131

  Fly  1186 ----ASHPPDGISLMELAALADLLGLEGLKEVTAHALKTNYCHNFHK----PCSGCSDGILQVLP 1242
                ..:..:..||.:::.|.|.                  |..|.:    ||: |    |.:..
Human   132 TTENVQYLFETSSLFQISVLRDA------------------CAKFLEEQLDPCN-C----LGIQR 173

  Fly  1243 VALNHALDDLYRKCLRWTCRHYLKVWPTRQFAQLPPDILGRCRQQIVAYMTSDTVLDTVLDCDHL 1307
            .|..|:|..|:.||..:..:.:..|....:|.:|..|       :::.|:.||   :.|:..:.:
Human   174 FADTHSLKTLFTKCKNFALQTFEDVSQHEEFLELDKD-------ELIDYICSD---ELVIGKEEM 228

  Fly  1308 LAQLSAYRWGHVCEQLVREILEAAYAYV------GDHFASLIASDSFL-------SLGHDRSRH 1358
            :.: :..||.:....|.|.:|.....:|      .::|...:..|..:       .|.|:..|:
Human   229 VFE-AVMRWVYRAVDLRRPLLHELLTHVRLPLLHPNYFVQTVEVDQLIQNSPECYQLLHEARRY 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13917NP_001189017.1 BTB 1117..>1185 CDD:279045 18/74 (24%)
BTB 1128..>1191 CDD:197585 16/73 (22%)
BACK 1238..>1281 CDD:197943 11/42 (26%)
KLHL24NP_001336342.1 BTB 62..591 CDD:333434 52/264 (20%)
KELCH repeat 354..393 CDD:276965
KELCH repeat 397..466 CDD:276965
KELCH repeat 469..514 CDD:276965
KELCH repeat 517..556 CDD:276965
KELCH repeat 559..604 CDD:276965
Kelch 570..616 CDD:128874
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.