DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13917 and spopla

DIOPT Version :9

Sequence 1:NP_001189017.1 Gene:CG13917 / 38186 FlyBaseID:FBgn0035237 Length:2019 Species:Drosophila melanogaster
Sequence 2:NP_001013465.1 Gene:spopla / 541318 ZFINID:ZDB-GENE-050320-3 Length:392 Species:Danio rerio


Alignment Length:285 Identity:58/285 - (20%)
Similarity:95/285 - (33%) Gaps:85/285 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly  1055 NFSKEFSNSLPNGMTLEQVQGQQ---VDYIQTDLSAD-----------------SSLASSFSRSG 1099
            |..:|.:.::.:......|||:.   ..:|:.|...|                 |.:..|.:.||
Zfish   108 NAKREETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISG 172

  Fly  1100 MDESSLSCRQPRRLGEDLLKMFLQEIATDMLVEVHGRRIRAHKCILRSRCQYFAAMLAGHGSQSV 1164
            ....::......:|.:||..::.....||..:.|.|:..:|||.||.:|...|.||......:|.
Zfish   173 QSNMNMLKVPECQLSDDLGNLWECSRFTDCSLYVGGQEFKAHKSILAARSPVFNAMFEHEMEESK 237

  Fly  1165 ---VSLQGYSYAAVHFALCHIYSGASHPPDGISLME-LAALADLLGLEGLKEVTAHALKTNYCH- 1224
               |.:...........:..||:|.:  |:...:.: |.|.||...||.||.:...||    |: 
Zfish   238 KNRVDISDVEPEVFKEMMGFIYTGKA--PNLEKMADSLLAAADKYALERLKVMCEEAL----CNS 296

  Fly  1225 --------------------------NFHKPCS-----GCSDG-------------------ILQ 1239
                                      :|...||     ||.||                   ::|
Zfish   297 LSVENVADTLILADLHSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNSNHATDIMETAGWKSMIQ 361

  Fly  1240 VLPVALNHALDDLYRKCLRWTCRHY 1264
            ..|    |.:.:.:|......|.|:
Zfish   362 SHP----HLVAEAFRALASAQCPHF 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13917NP_001189017.1 BTB 1117..>1185 CDD:279045 18/70 (26%)
BTB 1128..>1191 CDD:197585 17/65 (26%)
BACK 1238..>1281 CDD:197943 6/27 (22%)
spoplaNP_001013465.1 MATH 28..166 CDD:295307 9/57 (16%)
BTB 190..294 CDD:279045 30/109 (28%)
BTB 201..297 CDD:197585 29/101 (29%)
SPOP_C 297..377 CDD:269807 11/83 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.